BLASTX 7.6.2 Query= RU37927 /QuerySize=263 (262 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G34190.1 | Symbols: anac017 | anac017 (Arabido... 45 7e-006 >TAIR9_protein||AT1G34190.1 | Symbols: anac017 | anac017 (Arabidopsis NAC domain containing protein 17); transcription factor | chr1:12451729-12453914 FORWARD Length = 558 Score = 45 bits (105), Expect = 7e-006 Identities = 24/48 (50%) Frame = +3 Query: 114 SAFCDGHFWQPGFRFHPTDEELVXXXXXXXXXXXXXXXNVIAETDVYK 257 S F G F PGFRFHPTDEELV NVI DVYK Sbjct: 8 SCFKGGKFSAPGFRFHPTDEELVMYYLKRKICRKRLRVNVIGVVDVYK 55 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,440,711,220 Number of Sequences: 33410 Number of Extensions: 5440711220 Number of Successful Extensions: 287226300 Number of sequences better than 0.0: 0 |