BLASTX 7.6.2 Query= RU39685 /QuerySize=252 (251 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G04330.1 | Symbols: | unknown protein | chr1:... 48 9e-007 >TAIR9_protein||AT1G04330.1 | Symbols: | unknown protein | chr1:1161584-1161886 REVERSE Length = 101 Score = 48 bits (113), Expect = 9e-007 Identities = 27/48 (56%), Positives = 34/48 (70%), Gaps = 3/48 (6%) Frame = +2 Query: 92 TSPDLPPAPRRQPSRLQRRAPPPASLQINPV-ADWNVAIPLLSPLVLP 232 T+ ++ + R+ SRLQRRAPPP L+INP A+W VAIPLLSP P Sbjct: 4 TARNISGSGNRKSSRLQRRAPPP--LKINPCEANWKVAIPLLSPTESP 49 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,582,894,864 Number of Sequences: 33410 Number of Extensions: 5582894864 Number of Successful Extensions: 292430779 Number of sequences better than 0.0: 0 |