BLASTX 7.6.2 Query= RU39800 /QuerySize=179 (178 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G14460.1 | Symbols: | disease resistance prot... 53 3e-008 >TAIR9_protein||AT3G14460.1 | Symbols: | disease resistance protein (NBS-LRR class), putative | chr3:4851990-4856264 REVERSE Length = 1425 Score = 53 bits (126), Expect = 3e-008 Identities = 27/57 (47%), Positives = 34/57 (59%) Frame = +2 Query: 2 LQILLRKKLDGKRYLLVLDDVWNVKRESWLQLNDLLKGGAKGSKIVVTTRSTKVTAL 172 LQI L+K L GKR+LLVLDD W+ W +GSKIV+TTRS V+ + Sbjct: 261 LQIQLKKTLSGKRFLLVLDDFWSESDSEWESFQVAFTDAEEGSKIVLTTRSEIVSTV 317 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,582,894,864 Number of Sequences: 33410 Number of Extensions: 5582894864 Number of Successful Extensions: 292430779 Number of sequences better than 0.0: 0 |