BLASTX 7.6.2 Query= RU40470 /QuerySize=227 (226 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G57360.1 | Symbols: ZTL, LKP1, ADO1, FKL2 | ZT... 57 3e-009 TAIR9_protein||AT5G57360.2 | Symbols: ZTL, LKP1, ADO1, FKL2 | ZT... 57 3e-009 TAIR9_protein||AT2G18915.1 | Symbols: LKP2, ADO2 | LKP2 (LOV KEL... 50 3e-007 TAIR9_protein||AT2G18915.2 | Symbols: LKP2, ADO2 | LKP2 (LOV KEL... 50 3e-007 >TAIR9_protein||AT5G57360.1 | Symbols: ZTL, LKP1, ADO1, FKL2 | ZTL (ZEITLUPE); protein binding / ubiquitin-protein ligase | chr5:23241597-23244256 FORWARD Length = 610 Score = 57 bits (135), Expect = 3e-009 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 94 VENLLQTAPCGIVVTDAIDPDHPIIYVNTVF 2 V NLL TAPCG VVTDA++PD PIIYVNTVF Sbjct: 36 VGNLLHTAPCGFVVTDAVEPDQPIIYVNTVF 66 >TAIR9_protein||AT5G57360.2 | Symbols: ZTL, LKP1, ADO1, FKL2 | ZTL (ZEITLUPE); protein binding / ubiquitin-protein ligase | chr5:23241597-23244415 FORWARD Length = 627 Score = 57 bits (135), Expect = 3e-009 Identities = 25/31 (80%), Positives = 27/31 (87%) Frame = -1 Query: 94 VENLLQTAPCGIVVTDAIDPDHPIIYVNTVF 2 V NLL TAPCG VVTDA++PD PIIYVNTVF Sbjct: 36 VGNLLHTAPCGFVVTDAVEPDQPIIYVNTVF 66 >TAIR9_protein||AT2G18915.1 | Symbols: LKP2, ADO2 | LKP2 (LOV KELCH PROTEIN 2); protein binding / ubiquitin-protein ligase | chr2:8194792-8197255 REVERSE Length = 602 Score = 50 bits (117), Expect = 3e-007 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 94 VENLLQTAPCGIVVTDAIDPDHPIIYVNTVF 2 V +L TAPCG VV+DA++PD+PIIYVNTVF Sbjct: 36 VGSLPGTAPCGFVVSDALEPDNPIIYVNTVF 66 >TAIR9_protein||AT2G18915.2 | Symbols: LKP2, ADO2 | LKP2 (LOV KELCH PROTEIN 2); protein binding / ubiquitin-protein ligase | chr2:8194792-8197255 REVERSE Length = 612 Score = 50 bits (117), Expect = 3e-007 Identities = 22/31 (70%), Positives = 27/31 (87%) Frame = -1 Query: 94 VENLLQTAPCGIVVTDAIDPDHPIIYVNTVF 2 V +L TAPCG VV+DA++PD+PIIYVNTVF Sbjct: 36 VGSLPGTAPCGFVVSDALEPDNPIIYVNTVF 66 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,639,490,433 Number of Sequences: 33410 Number of Extensions: 5639490433 Number of Successful Extensions: 297436324 Number of sequences better than 0.0: 0 |