BLASTX 7.6.2 Query= RU41090 /QuerySize=217 (216 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G26210.1 | Symbols: AL4 | AL4 (ALFIN-LIKE 4); ... 62 5e-011 TAIR9_protein||AT5G20510.1 | Symbols: AL5 | AL5 (ALFIN-LIKE 5); ... 55 6e-009 TAIR9_protein||AT3G42790.1 | Symbols: AL3 | AL3 (ALFIN-LIKE 3); ... 53 4e-008 TAIR9_protein||AT1G14510.1 | Symbols: AL7 | AL7 (ALFIN-LIKE 7); ... 49 5e-007 TAIR9_protein||AT2G02470.1 | Symbols: AL6 | AL6 (ALFIN-LIKE 6); ... 47 2e-006 TAIR9_protein||AT5G05610.1 | Symbols: AL1 | AL1 (ALFIN-LIKE 1); ... 46 4e-006 TAIR9_protein||AT5G05610.2 | Symbols: AL1 | AL1 (ALFIN-LIKE 1); ... 46 4e-006 >TAIR9_protein||AT5G26210.1 | Symbols: AL4 | AL4 (ALFIN-LIKE 4); DNA binding / methylated histone residue binding | chr5:9158566-9160221 REVERSE Length = 256 Score = 62 bits (150), Expect = 5e-011 Identities = 28/34 (82%), Positives = 31/34 (91%) Frame = -3 Query: 109 MEVGAGHNPRTVEEVFRDFKGRRAGLLKALTTDV 8 ME G +NPRTVEEVFRDFKGRRAG++KALTTDV Sbjct: 1 MEAGGAYNPRTVEEVFRDFKGRRAGMIKALTTDV 34 >TAIR9_protein||AT5G20510.1 | Symbols: AL5 | AL5 (ALFIN-LIKE 5); DNA binding / methylated histone residue binding | chr5:6939991-6942846 REVERSE Length = 261 Score = 55 bits (132), Expect = 6e-009 Identities = 27/35 (77%), Positives = 31/35 (88%), Gaps = 1/35 (2%) Frame = -3 Query: 109 MEVGAGH-NPRTVEEVFRDFKGRRAGLLKALTTDV 8 ME G H +PRTVEEVFRDFKGRRAG+++ALTTDV Sbjct: 1 MEGGTAHYSPRTVEEVFRDFKGRRAGIIQALTTDV 35 >TAIR9_protein||AT3G42790.1 | Symbols: AL3 | AL3 (ALFIN-LIKE 3); DNA binding / methylated histone residue binding | chr3:14878128-14879618 REVERSE Length = 251 Score = 53 bits (125), Expect = 4e-008 Identities = 26/35 (74%), Positives = 30/35 (85%), Gaps = 1/35 (2%) Frame = -3 Query: 109 MEVGAG-HNPRTVEEVFRDFKGRRAGLLKALTTDV 8 ME GA +NPRTVEEVF+DFKGRR ++KALTTDV Sbjct: 1 MEGGAALYNPRTVEEVFKDFKGRRTAIVKALTTDV 35 >TAIR9_protein||AT1G14510.1 | Symbols: AL7 | AL7 (ALFIN-LIKE 7); DNA binding / methylated histone residue binding | chr1:4962171-4964154 REVERSE Length = 253 Score = 49 bits (115), Expect = 5e-007 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = -3 Query: 85 PRTVEEVFRDFKGRRAGLLKALTTDV 8 PRTVEEVF DF+GRRAGL+KAL+TDV Sbjct: 9 PRTVEEVFSDFRGRRAGLIKALSTDV 34 >TAIR9_protein||AT2G02470.1 | Symbols: AL6 | AL6 (ALFIN-LIKE 6); DNA binding / methylated histone residue binding | chr2:652837-654621 FORWARD Length = 257 Score = 47 bits (111), Expect = 2e-006 Identities = 21/26 (80%), Positives = 24/26 (92%) Frame = -3 Query: 85 PRTVEEVFRDFKGRRAGLLKALTTDV 8 PRTVEEVF DF+GRRAGL+KALT D+ Sbjct: 9 PRTVEEVFSDFRGRRAGLIKALTNDM 34 >TAIR9_protein||AT5G05610.1 | Symbols: AL1 | AL1 (ALFIN-LIKE 1); DNA binding / methylated histone residue binding | chr5:1677331-1678942 REVERSE Length = 242 Score = 46 bits (108), Expect = 4e-006 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = -3 Query: 88 NPRTVEEVFRDFKGRRAGLLKALTTDV 8 NPRTVEE+F+DF GRR+G L+AL+ DV Sbjct: 7 NPRTVEEIFKDFSGRRSGFLRALSVDV 33 >TAIR9_protein||AT5G05610.2 | Symbols: AL1 | AL1 (ALFIN-LIKE 1); DNA binding / methylated histone residue binding | chr5:1677331-1678942 REVERSE Length = 242 Score = 46 bits (108), Expect = 4e-006 Identities = 19/27 (70%), Positives = 24/27 (88%) Frame = -3 Query: 88 NPRTVEEVFRDFKGRRAGLLKALTTDV 8 NPRTVEE+F+DF GRR+G L+AL+ DV Sbjct: 7 NPRTVEEIFKDFSGRRSGFLRALSVDV 33 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,696,865,153 Number of Sequences: 33410 Number of Extensions: 5696865153 Number of Successful Extensions: 302473911 Number of sequences better than 0.0: 0 |