BLASTX 7.6.2 Query= RU41430 /QuerySize=242 (241 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G03220.1 | Symbols: | transcriptional co-acti... 45 8e-006 >TAIR9_protein||AT5G03220.1 | Symbols: | transcriptional co-activator-related | chr5:767617-768584 REVERSE Length = 169 Score = 45 bits (105), Expect = 8e-006 Identities = 21/39 (53%), Positives = 26/39 (66%) Frame = +3 Query: 123 MATATYXXXXXFYKLYKDYLQDPKSAXXXXXXIEGTYIC 239 MATATY +Y+LYKDY ++P SA IEGTY+C Sbjct: 1 MATATYPPPPPYYRLYKDYSENPNSAPEPPPPIEGTYVC 39 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,752,212,582 Number of Sequences: 33410 Number of Extensions: 5752212582 Number of Successful Extensions: 307483490 Number of sequences better than 0.0: 0 |