BLASTX 7.6.2 Query= RU41657 /QuerySize=248 (247 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G42070.1 | Symbols: ATNUDT23, ATNUDX23 | ATNUD... 77 1e-015 >TAIR9_protein||AT2G42070.1 | Symbols: ATNUDT23, ATNUDX23 | ATNUDX23 (ARABIDOPSIS THALIANA NUDIX HYDROLASE HOMOLOG 23); FAD diphosphatase/ hydrolase | chr2:17549669-17551066 REVERSE Length = 281 Score = 77 bits (189), Expect = 1e-015 Identities = 31/40 (77%), Positives = 35/40 (87%) Frame = +2 Query: 128 VQSVGNARKINFCQWCGGPTKHEVPDGEEKIRAICTVCDR 247 VQS G+ RKI FCQWCGGPTKHE+PDGEEK+RAICT C + Sbjct: 76 VQSAGDVRKIKFCQWCGGPTKHEIPDGEEKLRAICTHCGK 115 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,752,212,582 Number of Sequences: 33410 Number of Extensions: 5752212582 Number of Successful Extensions: 307483490 Number of sequences better than 0.0: 0 |