BLASTX 7.6.2 Query= RU41863 /QuerySize=315 (314 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G27320.1 | Symbols: ATGID1C, GID1C | GID1C (GA... 91 9e-020 TAIR9_protein||AT3G05120.1 | Symbols: ATGID1A, GID1A | GID1A (GA... 87 1e-018 TAIR9_protein||AT3G63010.1 | Symbols: ATGID1B, GID1B | GID1B (GA... 83 2e-017 >TAIR9_protein||AT5G27320.1 | Symbols: ATGID1C, GID1C | GID1C (GA INSENSITIVE DWARF1C); hydrolase | chr5:9629254-9630746 FORWARD Length = 345 Score = 91 bits (225), Expect = 9e-020 Identities = 43/48 (89%), Positives = 46/48 (95%) Frame = +2 Query: 170 EVDLTDSKMVVPLNTWVLISNFKLSYNLLRRPDGTFNRHLAEFLDRKV 313 EV+L +SK VVPLNTWVLISNFKL+YNLLRRPDGTFNRHLAEFLDRKV Sbjct: 6 EVNLIESKTVVPLNTWVLISNFKLAYNLLRRPDGTFNRHLAEFLDRKV 53 >TAIR9_protein||AT3G05120.1 | Symbols: ATGID1A, GID1A | GID1A (GA INSENSITIVE DWARF1A); hydrolase | chr3:1430682-1432287 FORWARD Length = 346 Score = 87 bits (215), Expect = 1e-018 Identities = 39/49 (79%), Positives = 47/49 (95%) Frame = +2 Query: 167 NEVDLTDSKMVVPLNTWVLISNFKLSYNLLRRPDGTFNRHLAEFLDRKV 313 +EV+L +S+ VVPLNTWVLISNFK++YN+LRRPDGTFNRHLAE+LDRKV Sbjct: 5 DEVNLIESRTVVPLNTWVLISNFKVAYNILRRPDGTFNRHLAEYLDRKV 53 >TAIR9_protein||AT3G63010.1 | Symbols: ATGID1B, GID1B | GID1B (GA INSENSITIVE DWARF1B); hydrolase | chr3:23289717-23290998 FORWARD Length = 359 Score = 83 bits (204), Expect = 2e-017 Identities = 38/49 (77%), Positives = 44/49 (89%) Frame = +2 Query: 167 NEVDLTDSKMVVPLNTWVLISNFKLSYNLLRRPDGTFNRHLAEFLDRKV 313 NEV+L + K +VPLNTWVLISNFKL+Y +LRRPDG+FNR LAEFLDRKV Sbjct: 5 NEVNLNECKRIVPLNTWVLISNFKLAYKVLRRPDGSFNRDLAEFLDRKV 53 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,802,862,040 Number of Sequences: 33410 Number of Extensions: 5802862040 Number of Successful Extensions: 312512627 Number of sequences better than 0.0: 0 |