BLASTX 7.6.2 Query= RU42002 /QuerySize=231 (230 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G68520.1 | Symbols: | zinc finger (B-box type... 57 3e-009 TAIR9_protein||AT1G25440.1 | Symbols: | zinc finger (B-box type... 54 1e-008 TAIR9_protein||AT1G73870.1 | Symbols: | zinc finger (B-box type... 49 7e-007 TAIR9_protein||AT5G57180.2 | Symbols: CIA2 | CIA2 (CHLOROPLAST I... 45 8e-006 TAIR9_protein||AT5G57180.1 | Symbols: CIA2 | CIA2 (CHLOROPLAST I... 45 8e-006 >TAIR9_protein||AT1G68520.1 | Symbols: | zinc finger (B-box type) family protein | chr1:25709331-25710749 REVERSE Length = 407 Score = 57 bits (135), Expect = 3e-009 Identities = 30/40 (75%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = +2 Query: 110 GCRMGMRGDNEQRPGREARVSRYREKRRTRLFSKKIRYEV 229 G +G GD GREARVSRYREKRRTRLFSKKIRYEV Sbjct: 346 GLHLGDAGDG----GREARVSRYREKRRTRLFSKKIRYEV 381 >TAIR9_protein||AT1G25440.1 | Symbols: | zinc finger (B-box type) family protein | chr1:8933939-8935284 REVERSE Length = 418 Score = 54 bits (129), Expect = 1e-008 Identities = 26/26 (100%) Frame = +2 Query: 152 GREARVSRYREKRRTRLFSKKIRYEV 229 GREARVSRYREKRRTRLFSKKIRYEV Sbjct: 360 GREARVSRYREKRRTRLFSKKIRYEV 385 >TAIR9_protein||AT1G73870.1 | Symbols: | zinc finger (B-box type) family protein | chr1:27779214-27780522 FORWARD Length = 393 Score = 49 bits (114), Expect = 7e-007 Identities = 23/25 (92%), Positives = 24/25 (96%) Frame = +2 Query: 155 REARVSRYREKRRTRLFSKKIRYEV 229 REARV RY+EKRRTRLFSKKIRYEV Sbjct: 345 REARVLRYKEKRRTRLFSKKIRYEV 369 >TAIR9_protein||AT5G57180.2 | Symbols: CIA2 | CIA2 (CHLOROPLAST IMPORT APPARATUS 2); transcription regulator | chr5:23168393-23170763 FORWARD Length = 436 Score = 45 bits (105), Expect = 8e-006 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 155 REARVSRYREKRRTRLFSKKIRYEV 229 REA V RY+EKRRTRLFSKKIRY+V Sbjct: 383 REASVLRYKEKRRTRLFSKKIRYQV 407 >TAIR9_protein||AT5G57180.1 | Symbols: CIA2 | CIA2 (CHLOROPLAST IMPORT APPARATUS 2); transcription regulator | chr5:23168393-23170294 FORWARD Length = 425 Score = 45 bits (105), Expect = 8e-006 Identities = 21/25 (84%), Positives = 23/25 (92%) Frame = +2 Query: 155 REARVSRYREKRRTRLFSKKIRYEV 229 REA V RY+EKRRTRLFSKKIRY+V Sbjct: 383 REASVLRYKEKRRTRLFSKKIRYQV 407 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,802,862,040 Number of Sequences: 33410 Number of Extensions: 5802862040 Number of Successful Extensions: 312512627 Number of sequences better than 0.0: 0 |