BLASTX 7.6.2 Query= RU42003 /QuerySize=249 (248 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G18440.1 | Symbols: AtALMT9 | AtALMT9 (aluminu... 51 1e-007 TAIR9_protein||AT1G18420.1 | Symbols: | CONTAINS InterPro DOMAI... 49 7e-007 >TAIR9_protein||AT3G18440.1 | Symbols: AtALMT9 | AtALMT9 (aluminum-activated malate transporter 9); anion channel | chr3:6328181-6330652 FORWARD Length = 599 Score = 51 bits (121), Expect = 1e-007 Identities = 26/52 (50%), Positives = 36/52 (69%) Frame = -2 Query: 211 GRFSDKVAGWCRTVQGVSRRAIKMGQSDPRKIVFSAKMGLALMLIFFADFPQ 56 G S+K++G + V+R+A +MG SDPRKIVFSAK+GLAL ++ F Q Sbjct: 57 GNLSEKISGVYDDAKDVARKAWEMGVSDPRKIVFSAKIGLALTIVALLIFYQ 108 >TAIR9_protein||AT1G18420.1 | Symbols: | CONTAINS InterPro DOMAIN/s: Uncharacterised protein family UPF0005 (InterPro:IPR006214); BEST Arabidopsis thaliana protein match is: AtALMT9 (aluminum-activated malate transporter 9); anion channel (TAIR:AT3G18440.1); Has 336 Blast hits to 334 proteins in 83 species: Archae - 0; Bacteria - 112; Metazoa - 1; Fungi - 9; Plants - 203; Viruses - 0; Other Eukaryotes - 11 (source: NCBI BLink). | chr1:6343330-6345689 FORWARD Length = 582 Score = 49 bits (114), Expect = 7e-007 Identities = 26/49 (53%), Positives = 35/49 (71%), Gaps = 4/49 (8%) Frame = -2 Query: 205 FSDKVAGWCRTVQGVSRRAIKMGQSDPRKIVFSAKMGLAL----MLIFF 71 FSDK+ G + ++ V A +MG +DPRK++FSAKMGLAL +LIFF Sbjct: 63 FSDKITGVVKKLKDVLVTAWEMGTADPRKMIFSAKMGLALTLTSILIFF 111 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,802,862,040 Number of Sequences: 33410 Number of Extensions: 5802862040 Number of Successful Extensions: 312512627 Number of sequences better than 0.0: 0 |