BLASTX 7.6.2 Query= RU43134 /QuerySize=141 (140 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G12090.1 | Symbols: TET6 | TET6 (TETRASPANIN6)... 57 3e-009 TAIR9_protein||AT4G23410.1 | Symbols: TET5 | TET5 (TETRASPANIN5)... 52 5e-008 >TAIR9_protein||AT3G12090.1 | Symbols: TET6 | TET6 (TETRASPANIN6) | chr3:3852326-3853714 REVERSE Length = 283 Score = 57 bits (135), Expect = 3e-009 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = +1 Query: 28 MYRLSNTVIGFLNLFTLLASIPIIGGGLWMARSSTT 135 MYR SNTVIG LNL TLLASIPIIG L+ ARSSTT Sbjct: 1 MYRFSNTVIGVLNLLTLLASIPIIGTALYKARSSTT 36 >TAIR9_protein||AT4G23410.1 | Symbols: TET5 | TET5 (TETRASPANIN5) | chr4:12224094-12225225 FORWARD Length = 238 Score = 52 bits (124), Expect = 5e-008 Identities = 23/36 (63%), Positives = 29/36 (80%) Frame = +1 Query: 28 MYRLSNTVIGFLNLFTLLASIPIIGGGLWMARSSTT 135 M R+SNTVIGFLN+ TL++SI ++G LWM RS TT Sbjct: 1 MNRMSNTVIGFLNILTLISSIVLLGSALWMGRSKTT 36 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,857,488,582 Number of Sequences: 33410 Number of Extensions: 5857488582 Number of Successful Extensions: 317535181 Number of sequences better than 0.0: 0 |