BLASTX 7.6.2 Query= RU43512 /QuerySize=266 (265 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G38690.1 | Symbols: | FUNCTIONS IN: molecular... 51 1e-007 TAIR9_protein||AT1G67780.1 | Symbols: | FUNCTIONS IN: molecular... 45 6e-006 >TAIR9_protein||AT5G38690.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 21 plant structures; EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s: DDT superfamily (InterPro:IPR018501), DDT subgroup (InterPro:IPR018500), Cell division cycle-associated protein (InterPro:IPR018866); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G67780.1); Has 492 Blast hits to 468 proteins in 97 species: Archae - 9; Bacteria - 41; Metazoa - 179; Fungi - 19; Plants - 99; Viruses - 2; Other Eukaryotes - 143 (source: NCBI BLink). | chr5:15479424-15482992 REVERSE Length = 573 Score = 51 bits (121), Expect = 1e-007 Identities = 22/35 (62%), Positives = 27/35 (77%) Frame = -3 Query: 107 SVLGIELPPEDAGNALQFMEFCSAFGEVLKFKKAQ 3 +V GI+L PEDAGN QF+EFCSAFG+ L +K Q Sbjct: 262 TVSGIDLAPEDAGNVFQFLEFCSAFGKALDLRKGQ 296 >TAIR9_protein||AT1G67780.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: shoot apex, flower, root, seed; EXPRESSED DURING: petal differentiation and expansion stage, E expanded cotyledon stage; CONTAINS InterPro DOMAIN/s: DDT superfamily (InterPro:IPR018501), DDT subgroup (InterPro:IPR018500), Cell division cycle-associated protein (InterPro:IPR018866); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G67270.1); Has 280 Blast hits to 277 proteins in 72 species: Archae - 0; Bacteria - 0; Metazoa - 114; Fungi - 47; Plants - 92; Viruses - 0; Other Eukaryotes - 27 (source: NCBI BLink). | chr1:25412816-25415530 FORWARD Length = 516 Score = 45 bits (106), Expect = 6e-006 Identities = 19/35 (54%), Positives = 25/35 (71%) Frame = -3 Query: 107 SVLGIELPPEDAGNALQFMEFCSAFGEVLKFKKAQ 3 SV G+ +P E+AGN Q EFCSAFG+ L+ K+ Q Sbjct: 208 SVSGVVIPTEEAGNVFQLFEFCSAFGKALELKEGQ 242 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,917,719,227 Number of Sequences: 33410 Number of Extensions: 5917719227 Number of Successful Extensions: 322562582 Number of sequences better than 0.0: 0 |