BLASTX 7.6.2 Query= RU44156 /QuerySize=316 (315 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G47550.1 | Symbols: | cysteine protease inhib... 60 2e-010 TAIR9_protein||AT4G16500.1 | Symbols: | cysteine protease inhib... 45 7e-006 >TAIR9_protein||AT5G47550.1 | Symbols: | cysteine protease inhibitor, putative / cystatin, putative | chr5:19286596-19286964 REVERSE Length = 123 Score = 60 bits (144), Expect = 2e-010 Identities = 28/55 (50%), Positives = 37/55 (67%) Frame = +3 Query: 147 GGWGPIGDLNKPYLKEIAEFAVSEISKQSRKKLVFQSVLKGERQVVRGFNYLLDI 311 GGW PI ++ P + EI EFAVSE +K+S L F++V+ GE QVV G NY L + Sbjct: 29 GGWSPISNVTDPQVVEIGEFAVSEYNKRSESGLKFETVVSGETQVVSGTNYRLKV 83 >TAIR9_protein||AT4G16500.1 | Symbols: | cysteine protease inhibitor family protein / cystatin family protein | chr4:9301530-9301883 REVERSE Length = 118 Score = 45 bits (105), Expect = 7e-006 Identities = 25/62 (40%), Positives = 39/62 (62%), Gaps = 5/62 (8%) Frame = +3 Query: 141 LSGGWG-----PIGDLNKPYLKEIAEFAVSEISKQSRKKLVFQSVLKGERQVVRGFNYLL 305 L GG G PI +++ P + +A++A+ E +K+S++KLVF V++G QVV G Y L Sbjct: 23 LGGGGGLGSRKPIKNVSDPDVVAVAKYAIEEHNKESKEKLVFVKVVEGTTQVVSGTKYDL 82 Query: 306 DI 311 I Sbjct: 83 KI 84 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |