BLASTX 7.6.2 Query= RU44385 /QuerySize=734 (733 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G27810.1 | Symbols: | unknown protein | chr4:... 51 6e-007 >TAIR9_protein||AT4G27810.1 | Symbols: | unknown protein | chr4:13854641-13855671 REVERSE Length = 197 Score = 51 bits (121), Expect = 6e-007 Identities = 24/43 (55%), Positives = 29/43 (67%) Frame = +2 Query: 200 SPKLPLFSISHIQSNEPSGCLTPPFYSSVSVPFRWEEEPGKPR 328 +PKLPLFSI ++ + G TPP + SVPF WEE PGKPR Sbjct: 14 TPKLPLFSIPFNRACDTPGLATPPVNIAGSVPFLWEEAPGKPR 56 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |