Blast details for RU44387 (Arabidopsis)


BLASTX 7.6.2

Query= RU44387 /QuerySize=642
        (641 letters)

Database: TAIR9 protein;
          33,410 sequences; 13,468,323 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

TAIR9_protein||AT1G49245.1 | Symbols:  | FUNCTIONS IN: molecular...     77   6e-015

>TAIR9_protein||AT1G49245.1 | Symbols:  | FUNCTIONS IN: molecular_function
        unknown; INVOLVED IN: biological_process unknown; LOCATED IN:
        cellular_component unknown; EXPRESSED IN: 22 plant structures;
        EXPRESSED DURING: 13 growth stages; CONTAINS InterPro DOMAIN/s:
        Prefoldin (InterPro:IPR009053); Has 8 Blast hits to 8 proteins in 4
        species: Archae - 0; Bacteria - 0; Metazoa - 1; Fungi - 0; Plants - 7;
        Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). |
        chr1:18218861-18219085 FORWARD

          Length = 75

 Score =  77 bits (189), Expect = 6e-015
 Identities = 36/71 (50%), Positives = 53/71 (74%)
 Frame = +2

Query: 107 ANTAAGDPKFDLVKQIRSHEVAIAELNALSSSRTVYQKNGNLFFRTTIQKASASEQEQLD 286
           A T + D +F+L K+I+  EV++ EL++LSSSR++YQKNGNLFF T+ +KA  S Q+QLD
Sbjct:   2 ATTTSSDREFELEKEIKRQEVSLDELSSLSSSRSIYQKNGNLFFLTSAEKAKISAQKQLD 61

Query: 287 LTKASLEKLNS 319
             K+ + K+ S
Sbjct:  62 YAKSEINKIRS 72

  Database: TAIR9 protein
    Posted date:  Wed Jul 08 15:16:08 2009
  Number of letters in database: 13,468,323
  Number of sequences in database:  33,410

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,954,139,568
Number of Sequences: 33410
Number of Extensions: 5954139568
Number of Successful Extensions: 327327827
Number of sequences better than 0.0: 0