BLASTX 7.6.2 Query= RU44687 /QuerySize=846 (845 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G03480.1 | Symbols: | dehydration-responsive ... 53 2e-007 TAIR9_protein||AT2G03480.2 | Symbols: | dehydration-responsive ... 53 2e-007 >TAIR9_protein||AT2G03480.1 | Symbols: | dehydration-responsive protein-related | chr2:1051509-1054090 FORWARD Length = 607 Score = 53 bits (126), Expect = 2e-007 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 679 VPDIY.NYRRLKEQAAVDYLELKSLSLGGS 768 VP+IY NYRR+KEQAAVDYL+L+SLSLG S Sbjct: 53 VPNIYSNYRRIKEQAAVDYLDLRSLSLGAS 82 >TAIR9_protein||AT2G03480.2 | Symbols: | dehydration-responsive protein-related | chr2:1051509-1054090 FORWARD Length = 596 Score = 53 bits (126), Expect = 2e-007 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +1 Query: 679 VPDIY.NYRRLKEQAAVDYLELKSLSLGGS 768 VP+IY NYRR+KEQAAVDYL+L+SLSLG S Sbjct: 53 VPNIYSNYRRIKEQAAVDYLDLRSLSLGAS 82 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |