BLASTX 7.6.2 Query= RU45054 /QuerySize=406 (405 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G23580.1 | Symbols: RNR2, RNR2A | RNR2A (RIBON... 55 1e-008 >TAIR9_protein||AT3G23580.1 | Symbols: RNR2, RNR2A | RNR2A (RIBONUCLEOTIDE REDUCTASE 2A); ribonucleoside-diphosphate reductase | chr3:8460261-8462574 FORWARD Length = 342 Score = 55 bits (131), Expect = 1e-008 Identities = 25/33 (75%), Positives = 29/33 (87%) Frame = +3 Query: 285 FASSEEVDLSQDVQLWEALIDSKKHFISHVLAF 383 F ++EEVDLS DVQ WEAL DS+KHFISH+LAF Sbjct: 50 FWTAEEVDLSTDVQQWEALTDSEKHFISHILAF 82 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |