BLASTX 7.6.2 Query= RU45204 /QuerySize=174 (173 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G20800.1 | Symbols: | rcd1-like cell differen... 48 1e-006 >TAIR9_protein||AT3G20800.1 | Symbols: | rcd1-like cell differentiation protein, putative | chr3:7271412-7273897 REVERSE Length = 317 Score = 48 bits (113), Expect = 1e-006 Identities = 27/48 (56%), Positives = 30/48 (62%), Gaps = 2/48 (4%) Frame = +2 Query: 35 SSSCMYPPFGGPIGSKPGSAGAP--PDPEMASAEHLVLELRNPQLREN 172 SS M PFGGP S GAP D +ASAE LVL+L NP+LREN Sbjct: 6 SSLSMGTPFGGPSTSAQNPTGAPANKDRNLASAEQLVLDLSNPELREN 53 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |