BLASTX 7.6.2 Query= RU45242 /QuerySize=413 (412 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G09815.1 | Symbols: POLD4 | POLD4 (POLYMERASE ... 132 8e-032 >TAIR9_protein||AT1G09815.1 | Symbols: POLD4 | POLD4 (POLYMERASE DELTA 4); DNA-directed DNA polymerase | chr1:3189460-3190050 FORWARD Length = 125 Score = 132 bits (331), Expect = 8e-032 Identities = 63/107 (58%), Positives = 81/107 (75%), Gaps = 3/107 (2%) Frame = +3 Query: 96 RALYQQKKSTPAGGISQKKKTQGASA---AASLGSDVTQPSALISHGAPDLKDDYDEQEE 266 + Y+Q KS GGIS+ K + A AA+ GSDVTQP+ALISHG+ DL +DYD++EE Sbjct: 9 KGFYKQTKSNITGGISKSKPSSRKVAPKHAAAQGSDVTQPAALISHGSVDLNEDYDKEEE 68 Query: 267 VLRQFDLNTAYGPCFGITRLARWERACKLGMDPPKEVESLLKSGKAR 407 +LRQFD+N YGPC G+TRL RWERA +LGM+PP E+E LLK+GK + Sbjct: 69 MLRQFDMNITYGPCLGMTRLDRWERAVRLGMNPPNEIEKLLKTGKVQ 115 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |