BLASTX 7.6.2 Query= RU45260 /QuerySize=414 (413 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G28140.1 | Symbols: | unknown protein | chr1:... 79 1e-015 >TAIR9_protein||AT1G28140.1 | Symbols: | unknown protein | chr1:9833029-9834390 REVERSE Length = 281 Score = 79 bits (192), Expect = 1e-015 Identities = 39/53 (73%), Positives = 45/53 (84%), Gaps = 1/53 (1%) Frame = +1 Query: 256 TVYQGVYGPWSVDSTDVKEVILYRSGLVTAATSFVIAASTAFLP-DSFLATEI 411 TVY+GVYGPW++D DVKEVILYRSGLVTAA SFV A+S AFLP DS+L+ I Sbjct: 52 TVYKGVYGPWTIDQADVKEVILYRSGLVTAAASFVAASSAAFLPGDSWLSETI 104 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |