Blast details for RU48451 (Arabidopsis)


BLASTX 7.6.2

Query= RU48451 /QuerySize=176
        (175 letters)

Database: TAIR9 protein;
          33,410 sequences; 13,468,323 total letters
                                                                  Score    E
Sequences producing significant alignments:                       (bits) Value

TAIR9_protein||AT5G14240.1 | Symbols:  | FUNCTIONS IN: molecular...     61   1e-010

>TAIR9_protein||AT5G14240.1 | Symbols:  | FUNCTIONS IN: molecular_function
        unknown; INVOLVED IN: biological_process unknown; LOCATED IN:
        cellular_component unknown; EXPRESSED IN: 23 plant structures;
        EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s:
        Thioredoxin fold (InterPro:IPR012335), Phosducin (InterPro:IPR001200),
        Thioredoxin-like fold (InterPro:IPR012336); Has 750 Blast hits to 750
        proteins in 282 species: Archae - 0; Bacteria - 2; Metazoa - 486; Fungi
        - 126; Plants - 51; Viruses - 0; Other Eukaryotes - 85 (source: NCBI
        BLink). | chr5:4596223-4597568 REVERSE

          Length = 257

 Score =  61 bits (147), Expect = 1e-010
 Identities = 28/52 (53%), Positives = 33/52 (63%)
 Frame = -3

Query: 158 MRDYHYIYKDLDGAST*WDDIQAKLGNLXXXXXXXXXXXXXXXEDEASLPKD 3
           M DYH++YKD++GAST WDDIQ KLGNL               EDE+S PKD
Sbjct:   1 MADYHFVYKDIEGASTQWDDIQRKLGNLPEKAPAFKPPAYTPAEDESSAPKD 52

  Database: TAIR9 protein
    Posted date:  Wed Jul 08 15:16:08 2009
  Number of letters in database: 13,468,323
  Number of sequences in database:  33,410

Lambda     K     H
   0.267   0.041    0.140
Gapped
Lambda     K     H
   0.267   0.041    0.140
Matrix: blosum62
Gap Penalties: Existence: 11, Extension: 1
Number of Hits to DB: 5,954,139,568
Number of Sequences: 33410
Number of Extensions: 5954139568
Number of Successful Extensions: 327327827
Number of sequences better than 0.0: 0