BLASTX 7.6.2 Query= RU48451 /QuerySize=176 (175 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G14240.1 | Symbols: | FUNCTIONS IN: molecular... 61 1e-010 >TAIR9_protein||AT5G14240.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; EXPRESSED IN: 23 plant structures; EXPRESSED DURING: 15 growth stages; CONTAINS InterPro DOMAIN/s: Thioredoxin fold (InterPro:IPR012335), Phosducin (InterPro:IPR001200), Thioredoxin-like fold (InterPro:IPR012336); Has 750 Blast hits to 750 proteins in 282 species: Archae - 0; Bacteria - 2; Metazoa - 486; Fungi - 126; Plants - 51; Viruses - 0; Other Eukaryotes - 85 (source: NCBI BLink). | chr5:4596223-4597568 REVERSE Length = 257 Score = 61 bits (147), Expect = 1e-010 Identities = 28/52 (53%), Positives = 33/52 (63%) Frame = -3 Query: 158 MRDYHYIYKDLDGAST*WDDIQAKLGNLXXXXXXXXXXXXXXXEDEASLPKD 3 M DYH++YKD++GAST WDDIQ KLGNL EDE+S PKD Sbjct: 1 MADYHFVYKDIEGASTQWDDIQRKLGNLPEKAPAFKPPAYTPAEDESSAPKD 52 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |