BLASTX 7.6.2 Query= RU49256 /QuerySize=195 (194 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G02980.1 | Symbols: ABP1, ABP | ABP1 (ENDOPLAS... 58 9e-010 >TAIR9_protein||AT4G02980.1 | Symbols: ABP1, ABP | ABP1 (ENDOPLASMIC RETICULUM AUXIN BINDING PROTEIN 1); auxin binding | chr4:1319902-1321449 REVERSE Length = 199 Score = 58 bits (139), Expect = 9e-010 Identities = 25/42 (59%), Positives = 33/42 (78%) Frame = -1 Query: 128 SEASKCSVQEFPVVRNISELPQNSYGRGGLAHTTVAGSLLHG 3 S + C + P+VRNIS+LPQ++YGR GL+H TVAGS+LHG Sbjct: 31 SLGAPCPINGLPIVRNISDLPQDNYGRPGLSHMTVAGSVLHG 72 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |