BLASTX 7.6.2 Query= RU50493 /QuerySize=205 (204 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G15000.1 | Symbols: scpl50 | scpl50 (serine ca... 47 2e-006 >TAIR9_protein||AT1G15000.1 | Symbols: scpl50 | scpl50 (serine carboxypeptidase-like 50); serine-type carboxypeptidase | chr1:5168613-5169947 FORWARD Length = 445 Score = 47 bits (111), Expect = 2e-006 Identities = 19/36 (52%), Positives = 27/36 (75%) Frame = +2 Query: 89 PNKPLPTRSGYLPVNPTTNSAIYYTFYEATKPQSHL 196 P++ LPT+SGYLPV P S+++Y FYEA +P + L Sbjct: 29 PDEALPTKSGYLPVKPAPGSSMFYAFYEAQEPTTPL 64 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |