BLASTX 7.6.2 Query= RU50941 /QuerySize=181 (180 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G13340.1 | Symbols: | unknown protein | chr5:... 70 2e-013 TAIR9_protein||AT1G10890.1 | Symbols: | unknown protein | chr1:... 63 3e-011 >TAIR9_protein||AT5G13340.1 | Symbols: | unknown protein | chr5:4277939-4279397 REVERSE Length = 243 Score = 70 bits (170), Expect = 2e-013 Identities = 33/52 (63%), Positives = 44/52 (84%) Frame = -2 Query: 158 ELKRLEEETAQRIEEAIRKNVEERLSSDDVKLQVERRIEEGRKKLLEDVQAQ 3 ELKRLEEETAQRIEEA+RKNVEER+ +++VK ++ERR +E +K+ DV+ Q Sbjct: 88 ELKRLEEETAQRIEEAVRKNVEERMKTEEVKEEIERRTKEAYEKMFLDVEIQ 139 >TAIR9_protein||AT1G10890.1 | Symbols: | unknown protein | chr1:3628081-3630545 FORWARD Length = 289 Score = 63 bits (152), Expect = 3e-011 Identities = 30/52 (57%), Positives = 41/52 (78%) Frame = -2 Query: 158 ELKRLEEETAQRIEEAIRKNVEERLSSDDVKLQVERRIEEGRKKLLEDVQAQ 3 ELK +EEET +R+EEAIRK VEE L S+ +K+++ +EEGRK+L E+V AQ Sbjct: 125 ELKLIEEETVKRVEEAIRKKVEESLQSEKIKMEILTLLEEGRKRLNEEVAAQ 176 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |