BLASTX 7.6.2 Query= RU51997 /QuerySize=262 (261 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G03140.1 | Symbols: | splicing factor Prp18 f... 53 4e-008 >TAIR9_protein||AT1G03140.1 | Symbols: | splicing factor Prp18 family protein | chr1:754471-756223 REVERSE Length = 421 Score = 53 bits (125), Expect = 4e-008 Identities = 27/40 (67%), Positives = 31/40 (77%), Gaps = 4/40 (10%) Frame = -3 Query: 121 LTDEQKIDLINIPKPEVIRRLRILKQPITLFGEDDDARLD 2 LTDE I +P+ EVIRRLR LKQP+TLFGEDD +RLD Sbjct: 97 LTDENLI----LPRQEVIRRLRFLKQPMTLFGEDDQSRLD 132 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |