BLASTX 7.6.2 Query= RU52089 /QuerySize=187 (186 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G03110.1 | Symbols: | FUNCTIONS IN: molecular... 45 8e-006 >TAIR9_protein||AT5G03110.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: plasma membrane; BEST Arabidopsis thaliana protein match is: protamine P1 family protein (TAIR:AT2G37100.1); Has 43 Blast hits to 42 proteins in 5 species: Archae - 0; Bacteria - 0; Metazoa - 0; Fungi - 0; Plants - 43; Viruses - 0; Other Eukaryotes - 0 (source: NCBI BLink). | chr5:730346-731197 FORWARD Length = 284 Score = 45 bits (105), Expect = 8e-006 Identities = 22/33 (66%), Positives = 26/33 (78%) Frame = +3 Query: 78 NALLLTRCRSAPYRSSSLASRFWGSPDRAKEET 176 NALLLTR RSAPYRSSSLA RFW ++ + E+ Sbjct: 182 NALLLTRSRSAPYRSSSLAFRFWEENNQREVES 214 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |