BLASTX 7.6.2 Query= RU53428 /QuerySize=262 (261 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G58760.1 | Symbols: DDB2 | DDB2 (damaged DNA-b... 103 2e-023 >TAIR9_protein||AT5G58760.1 | Symbols: DDB2 | DDB2 (damaged DNA-binding 2); nucleic acid binding / nucleotide binding / zinc ion binding | chr5:23730741-23733606 REVERSE Length = 558 Score = 103 bits (256), Expect = 2e-023 Identities = 45/55 (81%), Positives = 51/55 (92%), Gaps = 1/55 (1%) Frame = -3 Query: 172 KVDEAKKKGKAPITISL-KKVCKVCKKPGHEAGFKGATYIDCPMKPCFLCKMPGH 11 ++++ K KGKAPIT+ L KKVCKVCK+PGHEAGFKGATYIDCPMKPCFLCKMPGH Sbjct: 56 ELEKNKAKGKAPITVKLIKKVCKVCKQPGHEAGFKGATYIDCPMKPCFLCKMPGH 110 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |