BLASTX 7.6.2 Query= RU57688 /QuerySize=241 (240 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G19790.1 | Symbols: | clathrin adaptor comple... 66 4e-012 >TAIR9_protein||AT2G19790.1 | Symbols: | clathrin adaptor complex small chain family protein | chr2:8527302-8528395 FORWARD Length = 144 Score = 66 bits (159), Expect = 4e-012 Identities = 34/51 (66%), Positives = 35/51 (68%) Frame = +3 Query: 87 MGIRFILMVNKQGQTRLAQXXXXXXXXXXXXXXXXIVRKCLARNEQQCSFV 239 MGIRFILMVNKQGQTRLAQ IVRKCLARN+QQCSFV Sbjct: 1 MGIRFILMVNKQGQTRLAQYYEWLTLEERRALEGEIVRKCLARNDQQCSFV 51 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |