BLASTX 7.6.2 Query= RU58878 /QuerySize=239 (238 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G04190.1 | Symbols: | tetratricopeptide repea... 56 3e-009 >TAIR9_protein||AT1G04190.1 | Symbols: | tetratricopeptide repeat (TPR)-containing protein | chr1:1106617-1108557 REVERSE Length = 329 Score = 56 bits (134), Expect = 3e-009 Identities = 30/46 (65%), Positives = 36/46 (78%), Gaps = 2/46 (4%) Frame = +3 Query: 84 MAEAEGGSDK--KSGESLKDKGNEQFKAGNYLKAAALYTQAIKQDP 215 MAE G + ++ +SLK+KGNE FKAGN+LKAAALYTQAIK DP Sbjct: 1 MAEKAGKATNGGEAEKSLKEKGNEFFKAGNFLKAAALYTQAIKLDP 46 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |