BLASTX 7.6.2 Query= RU59238 /QuerySize=282 (281 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G27350.1 | Symbols: | FUNCTIONS IN: molecular... 64 2e-011 TAIR9_protein||AT1G27330.1 | Symbols: | FUNCTIONS IN: molecular... 64 2e-011 >TAIR9_protein||AT1G27350.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: biological_process unknown; LOCATED IN: cellular_component unknown; CONTAINS InterPro DOMAIN/s: Ribosome associated membrane RAMP4 (InterPro:IPR010580); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G27330.1); Has 267 Blast hits to 267 proteins in 83 species: Archae - 0; Bacteria - 0; Metazoa - 183; Fungi - 0; Plants - 55; Viruses - 0; Other Eukaryotes - 29 (source: NCBI BLink). | chr1:9498319-9499303 REVERSE Length = 69 Score = 64 bits (154), Expect = 2e-011 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 188 PETTAKKGKDYPVGPILLGFFIFVVVGSSLF 280 PETT KKGKDYPVGPILLGFF+FVV+GSSLF Sbjct: 26 PETTTKKGKDYPVGPILLGFFVFVVIGSSLF 56 >TAIR9_protein||AT1G27330.1 | Symbols: | FUNCTIONS IN: molecular_function unknown; INVOLVED IN: response to oxidative stress; LOCATED IN: cellular_component unknown; EXPRESSED IN: male gametophyte, pollen tube; EXPRESSED DURING: L mature pollen stage, M germinated pollen stage; CONTAINS InterPro DOMAIN/s: Ribosome associated membrane RAMP4 (InterPro:IPR010580); BEST Arabidopsis thaliana protein match is: unknown protein (TAIR:AT1G27350.1); Has 267 Blast hits to 267 proteins in 83 species: Archae - 0; Bacteria - 0; Metazoa - 183; Fungi - 0; Plants - 55; Viruses - 0; Other Eukaryotes - 29 (source: NCBI BLink). | chr1:9493064-9493898 FORWARD Length = 69 Score = 64 bits (154), Expect = 2e-011 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +2 Query: 188 PETTAKKGKDYPVGPILLGFFIFVVVGSSLF 280 PETT KKGKDYPVGPILLGFF+FVV+GSSLF Sbjct: 26 PETTTKKGKDYPVGPILLGFFVFVVIGSSLF 56 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |