BLASTX 7.6.2 Query= RU59475 /QuerySize=199 (198 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT4G18260.1 | Symbols: | cytochrome B561-related... 62 6e-011 >TAIR9_protein||AT4G18260.1 | Symbols: | cytochrome B561-related | chr4:10093524-10097337 REVERSE Length = 546 Score = 62 bits (149), Expect = 6e-011 Identities = 30/33 (90%), Positives = 31/33 (93%) Frame = +2 Query: 98 SLGWLTESTIMPKKHRAIAGVGASSIMELKAQL 196 SLGWLTES+IMPKKHRAI GVG SSIMELKAQL Sbjct: 303 SLGWLTESSIMPKKHRAIEGVGPSSIMELKAQL 335 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |