BLASTX 7.6.2 Query= RU59516 /QuerySize=198 (197 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT5G08670.1 | Symbols: | ATP binding / hydrogen ... 62 5e-011 TAIR9_protein||AT5G08680.1 | Symbols: | ATP synthase beta chain... 62 5e-011 TAIR9_protein||AT5G08690.1 | Symbols: | ATP synthase beta chain... 62 5e-011 >TAIR9_protein||AT5G08670.1 | Symbols: | ATP binding / hydrogen ion transporting ATP synthase, rotational mechanism | chr5:2818395-2821149 REVERSE Length = 557 Score = 62 bits (150), Expect = 5e-011 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 46 KYVELKESITSFQGVLDGKYDDLPEQSFYMVGG 144 KYV+LKE+I SFQG+LDGKYDDL EQSFYMVGG Sbjct: 507 KYVDLKENINSFQGLLDGKYDDLSEQSFYMVGG 539 >TAIR9_protein||AT5G08680.1 | Symbols: | ATP synthase beta chain, mitochondrial, putative | chr5:2821992-2824683 FORWARD Length = 560 Score = 62 bits (150), Expect = 5e-011 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 46 KYVELKESITSFQGVLDGKYDDLPEQSFYMVGG 144 KYV+LKE+I SFQG+LDGKYDDL EQSFYMVGG Sbjct: 510 KYVDLKENINSFQGLLDGKYDDLSEQSFYMVGG 542 >TAIR9_protein||AT5G08690.1 | Symbols: | ATP synthase beta chain 2, mitochondrial | chr5:2825739-2828352 FORWARD Length = 557 Score = 62 bits (150), Expect = 5e-011 Identities = 28/33 (84%), Positives = 31/33 (93%) Frame = +1 Query: 46 KYVELKESITSFQGVLDGKYDDLPEQSFYMVGG 144 KYV+LKE+I SFQG+LDGKYDDL EQSFYMVGG Sbjct: 507 KYVDLKENINSFQGLLDGKYDDLSEQSFYMVGG 539 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |