BLASTX 7.6.2 Query= RU60301 /QuerySize=328 (327 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT1G78310.1 | Symbols: | VQ motif-containing pro... 57 2e-009 >TAIR9_protein||AT1G78310.1 | Symbols: | VQ motif-containing protein | chr1:29464003-29464938 REVERSE Length = 312 Score = 57 bits (135), Expect = 2e-009 Identities = 25/33 (75%), Positives = 28/33 (84%) Frame = +1 Query: 229 RSTAPLSPLPPFPTVHASAESPVSAYMRFFHNS 327 R TAPLSPLPP P VHA+AESPVS+YMR+ NS Sbjct: 168 RPTAPLSPLPPLPPVHAAAESPVSSYMRYLQNS 200 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |