BLASTX 7.6.2 Query= RU60560 /QuerySize=216 (215 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT3G59380.1 | Symbols: FTA, PLP, ATFTA, PFT/PGGT-... 76 3e-015 >TAIR9_protein||AT3G59380.1 | Symbols: FTA, PLP, ATFTA, PFT/PGGT-IALPHA | FTA (FARNESYLTRANSFERASE A); farnesyltranstransferase/ protein heterodimerization/ protein prenyltransferase | chr3:21944209-21945781 FORWARD Length = 327 Score = 76 bits (186), Expect = 3e-015 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 130 VPLRSRPEFSDVIPVEQDDGPNPVVPITYKEEFRETMDYFRAL 2 VPL R E+SDV+P+ QDDGPNPVVPI YKEEFRETMDYFRA+ Sbjct: 7 VPLSQRLEWSDVVPLTQDDGPNPVVPIAYKEEFRETMDYFRAI 49 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |