BLASTX 7.6.2 Query= RU60656 /QuerySize=617 (616 letters) Database: TAIR9 protein; 33,410 sequences; 13,468,323 total letters Score E Sequences producing significant alignments: (bits) Value TAIR9_protein||AT2G33390.1 | Symbols: | unknown protein | chr2:... 82 3e-016 >TAIR9_protein||AT2G33390.1 | Symbols: | unknown protein | chr2:14151714-14152698 FORWARD Length = 99 Score = 82 bits (200), Expect = 3e-016 Identities = 39/76 (51%), Positives = 47/76 (61%) Frame = +1 Query: 10 SEKVEEQGNGDEDSESNSLLPPRKGGMSRKTNKTRRKVQWNDRNGNKLVEVLEYEPXXXX 189 S ++E+Q +E+SES LLPPRKGGMSR T+K +R VQWND G+ L EVL YEP Sbjct: 24 SSEIEDQIFEEEESESQCLLPPRKGGMSRSTDKIKRTVQWNDIKGDNLAEVLVYEPSEVS 83 Query: 190 XXXXXXXXXCICVIM* 237 CIC IM* Sbjct: 84 DTEDDDSDSCICTIM* 99 Database: TAIR9 protein Posted date: Wed Jul 08 15:16:08 2009 Number of letters in database: 13,468,323 Number of sequences in database: 33,410 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 5,954,139,568 Number of Sequences: 33410 Number of Extensions: 5954139568 Number of Successful Extensions: 327327827 Number of sequences better than 0.0: 0 |