BLASTX 7.6.2 Query= RU00004 /QuerySize=373 (372 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|110740129|dbj|BAF01964.1| hypothetical protein [Arabidopsis t... 184 2e-045 gi|167859793|gb|ACA04850.1| senescence-associated protein [Picea... 178 2e-043 gi|124484405|dbj|BAF46313.1| putative senescence-associated prot... 171 1e-041 gi|38640720|gb|AAR25995.1| putative senescence-associated protei... 169 5e-041 gi|156351361|ref|XP_001622476.1| predicted protein [Nematostella... 161 1e-038 >gi|110740129|dbj|BAF01964.1| hypothetical protein [Arabidopsis thaliana] Length = 167 Score = 184 bits (466), Expect = 2e-045 Identities = 90/104 (86%), Positives = 91/104 (87%) Frame = -1 Query: 339 GAADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFQRSKGSIGHAFTVRIRTGNQNQTS 160 G ADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKF+RSKGSIGHAFTVRIRT NQNQTS Sbjct: 3 GRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTENQNQTS 62 Query: 159 FYPFVPHEISVLVELILGHLRYLLTDVPPHPKLPQPRTNSTYRP 28 FYPFVPHEISVLVELILGHLRYLLTDVPP P P RP Sbjct: 63 FYPFVPHEISVLVELILGHLRYLLTDVPPQPNSPPDNVLRPDRP 106 >gi|167859793|gb|ACA04850.1| senescence-associated protein [Picea abies] Length = 157 Score = 178 bits (449), Expect = 2e-043 Identities = 87/104 (83%), Positives = 92/104 (88%), Gaps = 3/104 (2%) Frame = -1 Query: 339 GAADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFQRSKGSIGHAFTVRIRTGNQNQTS 160 G ADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKF++SKGSIGHAFTV IRT NQNQ S Sbjct: 3 GRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRKSKGSIGHAFTVCIRTENQNQMS 62 Query: 159 FYPFVPHEISVLVELILGHLRYLLTDVPPHPKLPQPRTNSTYRP 28 FYPFVPHEISVLVELILGHLRYLLTDVPP P P ++ +RP Sbjct: 63 FYPFVPHEISVLVELILGHLRYLLTDVPPQPNSP---PDNVFRP 103 >gi|124484405|dbj|BAF46313.1| putative senescence-associated protein [Ipomoea nil] Length = 91 Score = 171 bits (432), Expect = 1e-041 Identities = 82/87 (94%), Positives = 85/87 (97%) Frame = -1 Query: 339 GAADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFQRSKGSIGHAFTVRIRTGNQNQTS 160 G ADIEGSKSNVAMNAWLPQASYPCGNFSDTSSF+F+RSKGS+GHAFTVRIRTGNQNQTS Sbjct: 5 GRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFEFRRSKGSLGHAFTVRIRTGNQNQTS 64 Query: 159 FYPFVPHEISVLVELILGHLRYLLTDV 79 FYP VPHEISVLVELILGHLRYLLTDV Sbjct: 65 FYPSVPHEISVLVELILGHLRYLLTDV 91 >gi|38640720|gb|AAR25995.1| putative senescence-associated protein [Pyrus communis] Length = 93 Score = 169 bits (427), Expect = 5e-041 Identities = 81/83 (97%), Positives = 82/83 (98%) Frame = -1 Query: 339 GAADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFQRSKGSIGHAFTVRIRTGNQNQTS 160 G ADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKF+RSKGSIGHAFTVRIRTGNQNQTS Sbjct: 6 GRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFRRSKGSIGHAFTVRIRTGNQNQTS 65 Query: 159 FYPFVPHEISVLVELILGHLRYL 91 FYPFVPHEISVLVELILGHLRYL Sbjct: 66 FYPFVPHEISVLVELILGHLRYL 88 >gi|156351361|ref|XP_001622476.1| predicted protein [Nematostella vectensis] Length = 111 Score = 161 bits (407), Expect = 1e-038 Identities = 80/109 (73%), Positives = 84/109 (77%) Frame = -1 Query: 339 GAADIEGSKSNVAMNAWLPQASYPCGNFSDTSSFKFQRSKGSIGHAFTVRIRTGNQNQTS 160 G ADIEGSKSNVAMNAWLPQASYPCGNFSDTSS K ++KGSIGHAFTV I T NQNQ S Sbjct: 3 GRADIEGSKSNVAMNAWLPQASYPCGNFSDTSSLKLLKTKGSIGHAFTVCIHTENQNQVS 62 Query: 159 FYPFVPHEISVLVELILGHLRYLLTDVPPHPKLPQPRTNSTYRPGIQDP 13 FYPFV HEISVL+EL LGHLRY LTDVPP P T RP + P Sbjct: 63 FYPFVLHEISVLIELTLGHLRYRLTDVPPQPNSQPDSVFDTDRPAKERP 111 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,672,549,393 Number of Sequences: 7387702 Number of Extensions: 6672549393 Number of Successful Extensions: 8019734 Number of sequences better than 0.0: 0 |