BLASTX 7.6.2 Query= RU00146 /QuerySize=295 (294 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157347880|emb|CAO22467.1| unnamed protein product [Vitis vini... 70 4e-011 gi|18379088|ref|NP_563683.1| BSD domain-containing protein [Arab... 59 9e-008 gi|21553778|gb|AAM62871.1| unknown [Arabidopsis thaliana] 57 4e-007 gi|18413928|ref|NP_567396.1| BSD domain-containing protein [Arab... 53 5e-006 gi|5123952|emb|CAB45510.1| putative protein [Arabidopsis thaliana] 53 5e-006 >gi|157347880|emb|CAO22467.1| unnamed protein product [Vitis vinifera] Length = 334 Score = 70 bits (170), Expect = 4e-011 Identities = 30/53 (56%), Positives = 41/53 (77%) Frame = -1 Query: 162 MNTYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVD 4 +NTY+EEPEDL+ Y +WKL FVL++K EE +NL++ENG + I+ IVP VD Sbjct: 54 VNTYVEEPEDLDDYNKWKLEFVLDDKGEEIQNLLEENGAMEGIYNRIVPKNVD 106 >gi|18379088|ref|NP_563683.1| BSD domain-containing protein [Arabidopsis thaliana] Length = 470 Score = 59 bits (141), Expect = 9e-008 Identities = 25/54 (46%), Positives = 38/54 (70%) Frame = -1 Query: 162 MNTYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVDN 1 +NTY EEPED + Y +W+ F L+ KAEE E L++ENG + +++ +VP VD+ Sbjct: 163 LNTYCEEPEDSDDYKKWESAFSLDGKAEEMEKLLEENGDMKGVYKRVVPSMVDH 216 >gi|21553778|gb|AAM62871.1| unknown [Arabidopsis thaliana] Length = 315 Score = 57 bits (135), Expect = 4e-007 Identities = 25/51 (49%), Positives = 34/51 (66%) Frame = -1 Query: 156 TYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVD 4 T++ EP+DL + W LGF LEEK E L+ N V+ EI+EEIVP ++D Sbjct: 143 TFVREPDDLSDFENWSLGFKLEEKRNEIVELINGNKVVKEIYEEIVPVDID 193 >gi|18413928|ref|NP_567396.1| BSD domain-containing protein [Arabidopsis thaliana] Length = 316 Score = 53 bits (126), Expect = 5e-006 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = -1 Query: 156 TYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVD 4 T++ EP+DL + W LG LEEK E L+ N + EI+EEIVP EVD Sbjct: 144 TFVREPDDLSDFENWSLGLKLEEKRNEIVELINGNKGVKEIYEEIVPVEVD 194 >gi|5123952|emb|CAB45510.1| putative protein [Arabidopsis thaliana] Length = 365 Score = 53 bits (126), Expect = 5e-006 Identities = 25/51 (49%), Positives = 32/51 (62%) Frame = -1 Query: 156 TYLEEPEDLESYGEWKLGFVLEEKAEETENLMKENGVIGEIHEEIVPGEVD 4 T++ EP+DL + W LG LEEK E L+ N + EI+EEIVP EVD Sbjct: 193 TFVREPDDLSDFENWSLGLKLEEKRNEIVELINGNKGVKEIYEEIVPVEVD 243 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,672,549,393 Number of Sequences: 7387702 Number of Extensions: 6672549393 Number of Successful Extensions: 8019734 Number of sequences better than 0.0: 0 |