BLASTX 7.6.2 Query= RU00166 /QuerySize=430 (429 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147815555|emb|CAN70526.1| hypothetical protein [Vitis vinifera] 54 2e-006 gi|157340289|emb|CAO45966.1| unnamed protein product [Vitis vini... 52 7e-006 >gi|147815555|emb|CAN70526.1| hypothetical protein [Vitis vinifera] Length = 390 Score = 54 bits (129), Expect = 2e-006 Identities = 26/57 (45%), Positives = 37/57 (64%) Frame = -1 Query: 171 KSGTLTAGTGCSWMQDNSMHHNGAADSECGEGPLHSAFPAKAAEISSIEDLYEFISS 1 + G G G SWMQ+ SM + A++ +GPL+SA P AE+SS++DL+EFI S Sbjct: 12 EQGIFPMGHGSSWMQEKSMCCDTNANNGRXQGPLYSALPKTPAEVSSVQDLFEFICS 68 >gi|157340289|emb|CAO45966.1| unnamed protein product [Vitis vinifera] Length = 373 Score = 52 bits (124), Expect = 7e-006 Identities = 25/50 (50%), Positives = 35/50 (70%) Frame = -1 Query: 150 GTGCSWMQDNSMHHNGAADSECGEGPLHSAFPAKAAEISSIEDLYEFISS 1 G G SWMQ+ SM + A++ +GPL+SA P AE+SS++DL+EFI S Sbjct: 2 GHGSSWMQEKSMCCDTNANNGRKQGPLYSALPKTPAEVSSVQDLFEFICS 51 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 6,672,549,393 Number of Sequences: 7387702 Number of Extensions: 6672549393 Number of Successful Extensions: 8019734 Number of sequences better than 0.0: 0 |