BLASTX 7.6.2 Query= RU00904 /QuerySize=235 (234 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157353042|emb|CAO44932.1| unnamed protein product [Vitis vini... 72 1e-011 >gi|157353042|emb|CAO44932.1| unnamed protein product [Vitis vinifera] Length = 219 Score = 72 bits (175), Expect = 1e-011 Identities = 39/64 (60%), Positives = 47/64 (73%), Gaps = 2/64 (3%) Frame = +1 Query: 43 MASTLISNPVTTSDRPRDSSRIQRKKKKKLQAKQDHHLLVQHSQTKWKSEAQQQIYSSKL 222 MAS++ISNPVT SDR R+SS+ RKKKKK Q + + TKWKS+ QQQ+YSSKL Sbjct: 1 MASSVISNPVTNSDRSRESSK--RKKKKKNQIQSQVRDQQNQNHTKWKSQVQQQLYSSKL 58 Query: 223 LQAL 234 LQAL Sbjct: 59 LQAL 62 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 19,962,038,352 Number of Sequences: 7387702 Number of Extensions: 19962038352 Number of Successful Extensions: 23779584 Number of sequences better than 0.0: 0 |