BLASTX 7.6.2 Query= RU01510 /QuerySize=427 (426 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147780490|emb|CAN60507.1| hypothetical protein [Vitis vinifera] 70 2e-011 gi|8809582|dbj|BAA97133.1| membrane associated protein [Arabidop... 68 2e-010 gi|18423592|ref|NP_568804.1| ATMAMI (ARABIDOPSIS THALIANA MEMBRA... 68 2e-010 gi|1800147|gb|AAB41326.1| membrane associated protein [Arabidops... 68 2e-010 gi|87240479|gb|ABD32337.1| Major sperm protein [Medicago truncat... 65 8e-010 >gi|147780490|emb|CAN60507.1| hypothetical protein [Vitis vinifera] Length = 264 Score = 70 bits (171), Expect = 2e-011 Identities = 34/43 (79%), Positives = 35/43 (81%) Frame = +1 Query: 298 TDRSRSPKTVSSVARSLLPPRRRLRLDPASKLYFPYEPGKQVK 426 TD SP VSSVARS LP RRRLRLDPA+ LYFPYEPGKQVK Sbjct: 51 TDTRSSPSKVSSVARSFLPTRRRLRLDPANNLYFPYEPGKQVK 93 >gi|8809582|dbj|BAA97133.1| membrane associated protein [Arabidopsis thaliana] Length = 295 Score = 68 bits (164), Expect = 2e-010 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +1 Query: 307 SRSPKTVSSVARSLLPPRRRLRLDPASKLYFPYEPGKQVK 426 S+ P T+SSVARSLLP RRRLRLDP+S LYFPYEPGKQV+ Sbjct: 57 SKPPLTMSSVARSLLPARRRLRLDPSSYLYFPYEPGKQVR 96 >gi|18423592|ref|NP_568804.1| ATMAMI (ARABIDOPSIS THALIANA MEMBRANE-ASSOCIATED MANNITOL-INDUCED); structural molecule [Arabidopsis thaliana] Length = 266 Score = 68 bits (164), Expect = 2e-010 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +1 Query: 307 SRSPKTVSSVARSLLPPRRRLRLDPASKLYFPYEPGKQVK 426 S+ P T+SSVARSLLP RRRLRLDP+S LYFPYEPGKQV+ Sbjct: 57 SKPPLTMSSVARSLLPARRRLRLDPSSYLYFPYEPGKQVR 96 >gi|1800147|gb|AAB41326.1| membrane associated protein [Arabidopsis thaliana] Length = 265 Score = 68 bits (164), Expect = 2e-010 Identities = 32/40 (80%), Positives = 36/40 (90%) Frame = +1 Query: 307 SRSPKTVSSVARSLLPPRRRLRLDPASKLYFPYEPGKQVK 426 S+ P T+SSVARSLLP RRRLRLDP+S LYFPYEPGKQV+ Sbjct: 57 SKPPLTMSSVARSLLPARRRLRLDPSSYLYFPYEPGKQVR 96 >gi|87240479|gb|ABD32337.1| Major sperm protein [Medicago truncatula] Length = 266 Score = 65 bits (158), Expect = 8e-010 Identities = 30/40 (75%), Positives = 36/40 (90%) Frame = +1 Query: 307 SRSPKTVSSVARSLLPPRRRLRLDPASKLYFPYEPGKQVK 426 S + +VSSVARSLLP RRRL+LDP++KLYFPYEPGKQV+ Sbjct: 60 SHTSNSVSSVARSLLPTRRRLKLDPSNKLYFPYEPGKQVR 99 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,402,855,968 Number of Sequences: 7387702 Number of Extensions: 60402855968 Number of Successful Extensions: 33472321 Number of sequences better than 0.0: 0 |