BLASTX 7.6.2 Query= RU01667 /QuerySize=442 (441 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|4887022|gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [N... 90 4e-017 gi|4887020|gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Ni... 90 4e-017 gi|157360845|emb|CAO70656.1| unnamed protein product [Vitis vini... 88 1e-016 gi|22328628|ref|NP_193191.2| IAA14 (SOLITARY ROOT); transcriptio... 88 1e-016 gi|15229343|ref|NP_187124.1| IAA16 (indoleacetic acid-induced pr... 88 1e-016 >gi|4887022|gb|AAD32147.1|AF123509_1 Nt-iaa4.1 deduced protein [Nicotiana tabacum] Length = 220 Score = 90 bits (221), Expect = 4e-017 Identities = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 178 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 220 >gi|4887020|gb|AAD32146.1|AF123508_1 Nt-iaa28 deduced protein [Nicotiana tabacum] Length = 240 Score = 90 bits (221), Expect = 4e-017 Identities = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 198 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKCKNRS 240 >gi|157360845|emb|CAO70656.1| unnamed protein product [Vitis vinifera] Length = 238 Score = 88 bits (217), Expect = 1e-016 Identities = 41/43 (95%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFV+SCKRLRIMKGSEAIGLAPRAVEK KNRS Sbjct: 196 DWMLVGDVPWEMFVESCKRLRIMKGSEAIGLAPRAVEKCKNRS 238 >gi|22328628|ref|NP_193191.2| IAA14 (SOLITARY ROOT); transcription factor [Arabidopsis thaliana] Length = 228 Score = 88 bits (216), Expect = 1e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPW MFV+SCKRLRIMKGSEAIGLAPRA+EKFKNRS Sbjct: 186 DWMLVGDVPWPMFVESCKRLRIMKGSEAIGLAPRAMEKFKNRS 228 >gi|15229343|ref|NP_187124.1| IAA16 (indoleacetic acid-induced protein 16); transcription factor [Arabidopsis thaliana] Length = 236 Score = 88 bits (216), Expect = 1e-016 Identities = 40/43 (93%), Positives = 42/43 (97%) Frame = +2 Query: 2 DWMLVGDVPWEMFVDSCKRLRIMKGSEAIGLAPRAVEKFKNRS 130 DWMLVGDVPWEMFVDSCKR+RIMKGSEAIGLAPRA+EK KNRS Sbjct: 194 DWMLVGDVPWEMFVDSCKRIRIMKGSEAIGLAPRALEKCKNRS 236 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,402,855,968 Number of Sequences: 7387702 Number of Extensions: 60402855968 Number of Successful Extensions: 33472321 Number of sequences better than 0.0: 0 |