BLASTX 7.6.2 Query= RU01904 /QuerySize=487 (486 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|147866236|emb|CAN82042.1| hypothetical protein [Vitis vinifera] 55 1e-006 gi|157338851|emb|CAO42202.1| unnamed protein product [Vitis vini... 55 1e-006 >gi|147866236|emb|CAN82042.1| hypothetical protein [Vitis vinifera] Length = 549 Score = 55 bits (131), Expect = 1e-006 Identities = 27/48 (56%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = -2 Query: 479 SHAQHAQVYYTQPLAPAMTSQYQTMTAAAAMGLPEVSTQLPNDNIKQQ 336 S HAQ++Y Q +AP + QYQTMT+A A+ +PE S QL DNIKQQ Sbjct: 496 SDPAHAQIFYAQAMAPTL-PQYQTMTSAPAVVVPEASAQLSTDNIKQQ 542 >gi|157338851|emb|CAO42202.1| unnamed protein product [Vitis vinifera] Length = 369 Score = 55 bits (131), Expect = 1e-006 Identities = 27/48 (56%), Positives = 34/48 (70%), Gaps = 1/48 (2%) Frame = -2 Query: 479 SHAQHAQVYYTQPLAPAMTSQYQTMTAAAAMGLPEVSTQLPNDNIKQQ 336 S HAQ++Y Q +AP + QYQTMT+A A+ +PE S QL DNIKQQ Sbjct: 316 SDPAHAQIFYAQAMAPTL-PQYQTMTSAPAVVVPEASAQLSTDNIKQQ 362 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 60,402,855,968 Number of Sequences: 7387702 Number of Extensions: 60402855968 Number of Successful Extensions: 33472321 Number of sequences better than 0.0: 0 |