BLASTX 7.6.2 Query= RU03444 /QuerySize=835 (834 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|56562199|emb|CAI05895.1| putative auxin influx carrier protei... 89 4e-016 gi|57867899|gb|AAW57318.1| auxin influx protein [Populus tomentosa] 70 2e-010 gi|126217792|gb|ABN81349.1| auxin influx transport protein [Casu... 67 2e-009 gi|6650716|gb|AAF21982.1|AF115543_1 AUX1-like protein [Populus t... 66 3e-009 gi|5881784|emb|CAB55758.1| putative AUX1-like permease [Arabidop... 64 1e-008 >gi|56562199|emb|CAI05895.1| putative auxin influx carrier protein [Prunus avium] Length = 483 Score = 89 bits (219), Expect = 4e-016 Identities = 42/56 (75%), Positives = 46/56 (82%), Gaps = 1/56 (1%) Frame = -2 Query: 170 LPQKQAEEAIVSNFSEGADHEGKELGAEENKDGENASLFSVKNFLWHGGSAWDAWF 3 L QKQAEEAIVSNFSE DHEGKE ++K+ EN SLF+VKNFLWHGGS WDAWF Sbjct: 2 LAQKQAEEAIVSNFSEAHDHEGKE-DHHQDKEEENTSLFNVKNFLWHGGSVWDAWF 56 >gi|57867899|gb|AAW57318.1| auxin influx protein [Populus tomentosa] Length = 477 Score = 70 bits (169), Expect = 2e-010 Identities = 34/52 (65%), Positives = 37/52 (71%), Gaps = 5/52 (9%) Frame = -2 Query: 158 QAEEAIVSNFSEGADHEGKELGAEENKDGENASLFSVKNFLWHGGSAWDAWF 3 QAEEAIV N+SE HEGKE EEN SLFS+K+ LWHGGS WDAWF Sbjct: 6 QAEEAIVPNYSETDQHEGKEEETEENH-----SLFSIKSALWHGGSVWDAWF 52 >gi|126217792|gb|ABN81349.1| auxin influx transport protein [Casuarina glauca] Length = 480 Score = 67 bits (162), Expect = 2e-009 Identities = 33/51 (64%), Positives = 38/51 (74%), Gaps = 6/51 (11%) Frame = -2 Query: 155 AEEAIVSNFSEGADHEGKELGAEENKDGENASLFSVKNFLWHGGSAWDAWF 3 AEEAIVSNFSE +HEGK + + E+ S+FSVK FLWHGGS WDAWF Sbjct: 7 AEEAIVSNFSE-TEHEGK-----DQEQPEDHSIFSVKTFLWHGGSVWDAWF 51 >gi|6650716|gb|AAF21982.1|AF115543_1 AUX1-like protein [Populus tremula x Populus tremuloides] Length = 477 Score = 66 bits (160), Expect = 3e-009 Identities = 33/52 (63%), Positives = 37/52 (71%), Gaps = 5/52 (9%) Frame = -2 Query: 158 QAEEAIVSNFSEGADHEGKELGAEENKDGENASLFSVKNFLWHGGSAWDAWF 3 QAEEAIV ++SE HEGKE EEN SLFS+K+ LWHGGS WDAWF Sbjct: 6 QAEEAIVPSYSETDLHEGKEEETEENH-----SLFSIKSALWHGGSVWDAWF 52 >gi|5881784|emb|CAB55758.1| putative AUX1-like permease [Arabidopsis thaliana] Length = 485 Score = 64 bits (154), Expect = 1e-008 Identities = 32/58 (55%), Positives = 41/58 (70%), Gaps = 1/58 (1%) Frame = -2 Query: 173 MLPQKQAEEAI-VSNFSEGADHEGKELGAEENKDGENASLFSVKNFLWHGGSAWDAWF 3 M +KQAEE+I VS E A + ++ AEE+ DG + FS+K+FLWHGGSAWDAWF Sbjct: 1 MSGEKQAEESIVVSGDEEVAGRKVEDSAAEEDIDGNGGNGFSMKSFLWHGGSAWDAWF 58 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 121,122,045,638 Number of Sequences: 7387702 Number of Extensions: 121122045638 Number of Successful Extensions: 65962939 Number of sequences better than 0.0: 0 |