BLASTX 7.6.2 Query= RU05221 /QuerySize=380 (379 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157356301|emb|CAO62453.1| unnamed protein product [Vitis vini... 65 1e-009 >gi|157356301|emb|CAO62453.1| unnamed protein product [Vitis vinifera] Length = 632 Score = 65 bits (157), Expect = 1e-009 Identities = 38/89 (42%), Positives = 49/89 (55%), Gaps = 3/89 (3%) Frame = -3 Query: 269 NKVSSIEHATDALLSTHSRPTECSNTQPLSSGQFLSQYMAPKESPLPSFSAANSP-YPSQ 93 NK+ S E + S P S +Q +S+ F SQ +AP+E P SA + P +PSQ Sbjct: 7 NKLPSSEPYAKKISSNPLHPGASSTSQSVSAEGFSSQSLAPRELSSPGSSAVDFPHHPSQ 66 Query: 92 LPPPPPPSLSQGTSVAHVPQVHRDYNQRP 6 LPPPPP QG + H+PQ RDYN P Sbjct: 67 LPPPPP--FMQGVNAPHLPQPPRDYNLLP 93 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 168,862,090,769 Number of Sequences: 7387702 Number of Extensions: 168862090769 Number of Successful Extensions: 83690393 Number of sequences better than 0.0: 0 |