BLASTX 7.6.2 Query= RU05955 /QuerySize=532 (531 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|30961941|gb|AAP40022.1| callus-expressing factor [Nicotiana t... 92 2e-017 gi|3264767|gb|AAC24587.1| AP2 domain containing protein [Prunus ... 88 2e-016 gi|22074046|gb|AAK95687.1| transcription factor JERF1 [Lycopersi... 86 9e-016 gi|62526569|gb|AAX84670.1| ethylene response factor [Manihot esc... 86 2e-015 gi|87201358|gb|AAX07458.2| ethylene-responsive element binding p... 82 1e-014 >gi|30961941|gb|AAP40022.1| callus-expressing factor [Nicotiana tabacum] Length = 387 Score = 92 bits (227), Expect = 2e-017 Identities = 43/59 (72%), Positives = 49/59 (83%), Gaps = 2/59 (3%) Frame = +1 Query: 28 SEELSAFE--MKYCQTPYLEGSWDTSIDTFLNGDATQDGCNPVDLWSFDDLPSMSGGVF 198 SEELSAFE MK+ Q PYLEG+WD S+DTFLN ATQDG N +DLWSFDD+PS+ GGVF Sbjct: 329 SEELSAFETQMKFLQIPYLEGNWDASVDTFLNSSATQDGDNAMDLWSFDDVPSLLGGVF 387 >gi|3264767|gb|AAC24587.1| AP2 domain containing protein [Prunus armeniaca] Length = 280 Score = 88 bits (217), Expect = 2e-016 Identities = 39/51 (76%), Positives = 44/51 (86%) Frame = +1 Query: 22 TYSEELSAFEMKYCQTPYLEGSWDTSIDTFLNGDATQDGCNPVDLWSFDDL 174 T ++ELSAFEMKY QTPYL+GSWD S+D FL+GDATQDG N VDLW FDDL Sbjct: 225 TLTDELSAFEMKYFQTPYLDGSWDASVDAFLSGDATQDGGNSVDLWCFDDL 275 >gi|22074046|gb|AAK95687.1| transcription factor JERF1 [Lycopersicon esculentum] Length = 372 Score = 86 bits (212), Expect = 9e-016 Identities = 40/61 (65%), Positives = 47/61 (77%), Gaps = 2/61 (3%) Frame = +1 Query: 22 TYSEELSAFE--MKYCQTPYLEGSWDTSIDTFLNGDATQDGCNPVDLWSFDDLPSMSGGV 195 T SEELSAFE MK+ Q PYLEG+WD S+D FLN A QDG N +DLWSFDD+PS+ GG Sbjct: 312 TLSEELSAFESQMKFLQIPYLEGNWDASVDAFLNTSAIQDGGNAMDLWSFDDVPSLMGGA 371 Query: 196 F 198 + Sbjct: 372 Y 372 >gi|62526569|gb|AAX84670.1| ethylene response factor [Manihot esculenta] Length = 381 Score = 86 bits (210), Expect = 2e-015 Identities = 40/58 (68%), Positives = 47/58 (81%), Gaps = 1/58 (1%) Frame = +1 Query: 28 SEELSAFEMKY-CQTPYLEGSWDTSIDTFLNGDATQDGCNPVDLWSFDDLPSMSGGVF 198 SEEL AF+ + Q PYLEGSW+ S+D FLNGD TQDG NP+DLWSFDDLP+M GGV+ Sbjct: 324 SEELLAFDNQMNFQMPYLEGSWEASLDGFLNGDVTQDGGNPMDLWSFDDLPNMVGGVY 381 >gi|87201358|gb|AAX07458.2| ethylene-responsive element binding protein ERF2 [Gossypium hirsutum] Length = 390 Score = 82 bits (202), Expect = 1e-014 Identities = 39/62 (62%), Positives = 49/62 (79%), Gaps = 3/62 (4%) Frame = +1 Query: 22 TYSEELSAF--EMKYCQ-TPYLEGSWDTSIDTFLNGDATQDGCNPVDLWSFDDLPSMSGG 192 T S+EL A +MKY Q P++EG+WD +ID FLNGDATQDG NP+DLW+FDD P+M+ G Sbjct: 329 TLSDELLALDNQMKYFQMPPFIEGNWDATIDAFLNGDATQDGGNPMDLWNFDDFPTMAEG 388 Query: 193 VF 198 VF Sbjct: 389 VF 390 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 182,691,905,965 Number of Sequences: 7387702 Number of Extensions: 182691905965 Number of Successful Extensions: 98329402 Number of sequences better than 0.0: 0 |