BLASTX 7.6.2 Query= RU06045 /QuerySize=484 (483 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|5139697|dbj|BAA81687.1| expressed in cucumber hypocotyls [Cuc... 76 4e-013 gi|147770149|emb|CAN63268.1| hypothetical protein [Vitis vinifera] 75 9e-013 gi|188569545|gb|ACD63851.1| indoleacetic acid-induced-like prote... 75 9e-013 gi|115489444|ref|NP_001067209.1| Os12g0601300 [Oryza sativa (jap... 74 2e-012 gi|55416169|gb|AAV50046.1| auxin-induced protein [Saccharum hybr... 74 2e-012 >gi|5139697|dbj|BAA81687.1| expressed in cucumber hypocotyls [Cucumis sativus] Length = 230 Score = 76 bits (186), Expect = 4e-013 Identities = 34/35 (97%), Positives = 35/35 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKGKEA+GLAPRAMEKCKNRS Sbjct: 196 PWEMFVESCKRLRIMKGKEAIGLAPRAMEKCKNRS 230 >gi|147770149|emb|CAN63268.1| hypothetical protein [Vitis vinifera] Length = 235 Score = 75 bits (183), Expect = 9e-013 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNRS Sbjct: 201 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS 235 >gi|188569545|gb|ACD63851.1| indoleacetic acid-induced-like protein [Helianthus petiolaris] Length = 41 Score = 75 bits (183), Expect = 9e-013 Identities = 33/35 (94%), Positives = 35/35 (100%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFV+SCKRLRIMKGKEA+GLAPRAMEKCKNRS Sbjct: 7 PWEMFVDSCKRLRIMKGKEAIGLAPRAMEKCKNRS 41 >gi|115489444|ref|NP_001067209.1| Os12g0601300 [Oryza sativa (japonica cultivar-group)] Length = 277 Score = 74 bits (181), Expect = 2e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 243 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 277 >gi|55416169|gb|AAV50046.1| auxin-induced protein [Saccharum hybrid cultivar] Length = 188 Score = 74 bits (181), Expect = 2e-012 Identities = 33/35 (94%), Positives = 34/35 (97%) Frame = +1 Query: 40 PWEMFVESCKRLRIMKGKEAVGLAPRAMEKCKNRS 144 PWEMFVESCKRLRIMKG EA+GLAPRAMEKCKNRS Sbjct: 154 PWEMFVESCKRLRIMKGSEAIGLAPRAMEKCKNRS 188 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 182,691,905,965 Number of Sequences: 7387702 Number of Extensions: 182691905965 Number of Successful Extensions: 98329402 Number of sequences better than 0.0: 0 |