BLASTX 7.6.2 Query= RU06446 /QuerySize=531 (530 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|189908190|gb|ACE60220.1| plasma membrane aquaporin [Rosa hybr... 159 1e-037 gi|8071628|gb|AAF71820.1|AF141900_1 putative aquaporin PIP2-2 [V... 154 4e-036 gi|111379080|gb|ABH09327.1| putative aquaporin [Vitis vinifera] 154 4e-036 gi|157340589|emb|CAO47394.1| unnamed protein product [Vitis vini... 154 4e-036 gi|17940742|gb|AAL49750.1|AF452012_1 aquaporin-like protein [Pet... 151 4e-035 >gi|189908190|gb|ACE60220.1| plasma membrane aquaporin [Rosa hybrid cultivar] Length = 281 Score = 159 bits (401), Expect = 1e-037 Identities = 77/81 (95%), Positives = 78/81 (96%), Gaps = 1/81 (1%) Frame = +1 Query: 4 LGF*TVFVVHLATIPITGTGINPARSFGAAVIYNEEKVWDDQWIFWVGPFVGALCAAAYH 183 +GF VFV HLATIPITGTGINPARSFGAAVIYNEEKVWDDQWIFWVGPFVGALCAAAYH Sbjct: 202 IGF-AVFVEHLATIPITGTGINPARSFGAAVIYNEEKVWDDQWIFWVGPFVGALCAAAYH 260 Query: 184 QYILRAAAIKALGSFRSNPSN 246 QYILRAAAIKALGSFRSNPSN Sbjct: 261 QYILRAAAIKALGSFRSNPSN 281 >gi|8071628|gb|AAF71820.1|AF141900_1 putative aquaporin PIP2-2 [Vitis berlandieri x Vitis rupestris] Length = 279 Score = 154 bits (387), Expect = 4e-036 Identities = 74/81 (91%), Positives = 77/81 (95%), Gaps = 1/81 (1%) Frame = +1 Query: 4 LGF*TVFVVHLATIPITGTGINPARSFGAAVIYNEEKVWDDQWIFWVGPFVGALCAAAYH 183 +GF VF+VHLATIPITGTGINPARSFGAAVIYN EKVWDDQWIFWVGPFVGAL AAAYH Sbjct: 200 IGF-AVFMVHLATIPITGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYH 258 Query: 184 QYILRAAAIKALGSFRSNPSN 246 QYILRAAAIKALGSFRSNP+N Sbjct: 259 QYILRAAAIKALGSFRSNPTN 279 >gi|111379080|gb|ABH09327.1| putative aquaporin [Vitis vinifera] Length = 279 Score = 154 bits (387), Expect = 4e-036 Identities = 74/81 (91%), Positives = 77/81 (95%), Gaps = 1/81 (1%) Frame = +1 Query: 4 LGF*TVFVVHLATIPITGTGINPARSFGAAVIYNEEKVWDDQWIFWVGPFVGALCAAAYH 183 +GF VF+VHLATIPITGTGINPARSFGAAVIYN EKVWDDQWIFWVGPFVGAL AAAYH Sbjct: 200 IGF-AVFMVHLATIPITGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYH 258 Query: 184 QYILRAAAIKALGSFRSNPSN 246 QYILRAAAIKALGSFRSNP+N Sbjct: 259 QYILRAAAIKALGSFRSNPTN 279 >gi|157340589|emb|CAO47394.1| unnamed protein product [Vitis vinifera] Length = 279 Score = 154 bits (387), Expect = 4e-036 Identities = 74/81 (91%), Positives = 77/81 (95%), Gaps = 1/81 (1%) Frame = +1 Query: 4 LGF*TVFVVHLATIPITGTGINPARSFGAAVIYNEEKVWDDQWIFWVGPFVGALCAAAYH 183 +GF VF+VHLATIPITGTGINPARSFGAAVIYN EKVWDDQWIFWVGPFVGAL AAAYH Sbjct: 200 IGF-AVFMVHLATIPITGTGINPARSFGAAVIYNNEKVWDDQWIFWVGPFVGALAAAAYH 258 Query: 184 QYILRAAAIKALGSFRSNPSN 246 QYILRAAAIKALGSFRSNP+N Sbjct: 259 QYILRAAAIKALGSFRSNPTN 279 >gi|17940742|gb|AAL49750.1|AF452012_1 aquaporin-like protein [Petunia x hybrida] Length = 283 Score = 151 bits (379), Expect = 4e-035 Identities = 72/81 (88%), Positives = 76/81 (93%), Gaps = 1/81 (1%) Frame = +1 Query: 4 LGF*TVFVVHLATIPITGTGINPARSFGAAVIYNEEKVWDDQWIFWVGPFVGALCAAAYH 183 +GF VF+VHLATIPITGTGINPARSFGAAVIYN +KVWDD WIFWVGPFVGAL AAAYH Sbjct: 204 IGF-AVFMVHLATIPITGTGINPARSFGAAVIYNNDKVWDDHWIFWVGPFVGALAAAAYH 262 Query: 184 QYILRAAAIKALGSFRSNPSN 246 QYILRAAAIKALGSFRSNP+N Sbjct: 263 QYILRAAAIKALGSFRSNPTN 283 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 203,507,433,854 Number of Sequences: 7387702 Number of Extensions: 203507433854 Number of Successful Extensions: 120256368 Number of sequences better than 0.0: 0 |