BLASTX 7.6.2 Query= RU07222 /QuerySize=428 (427 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157342064|emb|CAO64177.1| unnamed protein product [Vitis vini... 64 3e-009 gi|15242694|ref|NP_201131.1| zinc finger (CCCH-type) family prot... 55 1e-006 gi|55819798|gb|AAV66094.1| At5g63260 [Arabidopsis thaliana] 55 1e-006 gi|15228379|ref|NP_190414.1| zinc finger (CCCH-type) family prot... 52 9e-006 >gi|157342064|emb|CAO64177.1| unnamed protein product [Vitis vinifera] Length = 478 Score = 64 bits (153), Expect = 3e-009 Identities = 34/71 (47%), Positives = 42/71 (59%), Gaps = 8/71 (11%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHLTSSTT-----SGLDHQLPFSDLANTKEAGIARSRSG 260 CTHY+RYGICKFGPACKFDHP++ +S + SG D PF + A R SG Sbjct: 411 CTHYNRYGICKFGPACKFDHPVNYGNSASAPSAESGQDQPPPF---GGSVTADGVRPGSG 467 Query: 259 TDDTIQLQQAV 227 + I +QQ V Sbjct: 468 NGNEILIQQPV 478 >gi|15242694|ref|NP_201131.1| zinc finger (CCCH-type) family protein [Arabidopsis thaliana] Length = 435 Score = 55 bits (130), Expect = 1e-006 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHLTSSTTS 335 CTHYSRYGICKFGPAC+FDH + T S +S Sbjct: 386 CTHYSRYGICKFGPACRFDHSIPPTFSPSS 415 >gi|55819798|gb|AAV66094.1| At5g63260 [Arabidopsis thaliana] Length = 435 Score = 55 bits (130), Expect = 1e-006 Identities = 22/30 (73%), Positives = 25/30 (83%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHLTSSTTS 335 CTHYSRYGICKFGPAC+FDH + T S +S Sbjct: 386 CTHYSRYGICKFGPACRFDHSIPPTFSPSS 415 >gi|15228379|ref|NP_190414.1| zinc finger (CCCH-type) family protein [Arabidopsis thaliana] Length = 448 Score = 52 bits (123), Expect = 9e-006 Identities = 21/30 (70%), Positives = 24/30 (80%) Frame = -1 Query: 424 CTHYSRYGICKFGPACKFDHPLHLTSSTTS 335 CT+YSRYGICKFGPAC+FDH + ST S Sbjct: 398 CTYYSRYGICKFGPACRFDHSVQPPYSTES 427 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 250,143,483,431 Number of Sequences: 7387702 Number of Extensions: 250143483431 Number of Successful Extensions: 138270154 Number of sequences better than 0.0: 0 |