BLASTX 7.6.2 Query= RU07540 /QuerySize=260 (259 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|118484415|gb|ABK94084.1| unknown [Populus trichocarpa] 57 3e-007 gi|147864286|emb|CAN83013.1| hypothetical protein [Vitis vinifera] 57 5e-007 gi|116785384|gb|ABK23702.1| unknown [Picea sitchensis] 55 1e-006 gi|15224648|ref|NP_180066.1| ATMAPR2 (ARABIDOPSIS THALIANA MEMBR... 54 2e-006 gi|48425750|pdb|1T0G|A Chain A, Hypothetical Protein At2g24940.1... 54 2e-006 >gi|118484415|gb|ABK94084.1| unknown [Populus trichocarpa] Length = 100 Score = 57 bits (136), Expect = 3e-007 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = -2 Query: 255 LQGLSDKEIGVLTDWENKFEAKYPVVGRVVS 163 L GL++KEIGVL DWE KFEAKYPVVGRVVS Sbjct: 70 LHGLTEKEIGVLDDWEKKFEAKYPVVGRVVS 100 >gi|147864286|emb|CAN83013.1| hypothetical protein [Vitis vinifera] Length = 99 Score = 57 bits (135), Expect = 5e-007 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = -2 Query: 255 LQGLSDKEIGVLTDWENKFEAKYPVVGRVV 166 L GLS+KE+GVL DWENKF+AKYPVVGRV+ Sbjct: 70 LDGLSEKEMGVLNDWENKFQAKYPVVGRVI 99 >gi|116785384|gb|ABK23702.1| unknown [Picea sitchensis] Length = 101 Score = 55 bits (132), Expect = 1e-006 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -2 Query: 255 LQGLSDKEIGVLTDWENKFEAKYPVVGRVV 166 L GL++KEIGVL DWE KFEAKYPVVGRVV Sbjct: 72 LDGLTEKEIGVLEDWEKKFEAKYPVVGRVV 101 >gi|15224648|ref|NP_180066.1| ATMAPR2 (ARABIDOPSIS THALIANA MEMBRANE-ASSOCIATED PROGESTERONE BINDING PROTEIN 2); heme binding / transition metal ion binding [Arabidopsis thaliana] Length = 100 Score = 54 bits (129), Expect = 2e-006 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 255 LQGLSDKEIGVLTDWENKFEAKYPVVGRVVS 163 L+GL++KEI L DWE KFEAKYPVVGRVVS Sbjct: 70 LEGLTEKEINTLNDWETKFEAKYPVVGRVVS 100 >gi|48425750|pdb|1T0G|A Chain A, Hypothetical Protein At2g24940.1 From Arabidopsis Thaliana Has A Cytochrome B5 Like Fold Length = 109 Score = 54 bits (129), Expect = 2e-006 Identities = 24/31 (77%), Positives = 27/31 (87%) Frame = -2 Query: 255 LQGLSDKEIGVLTDWENKFEAKYPVVGRVVS 163 L+GL++KEI L DWE KFEAKYPVVGRVVS Sbjct: 79 LEGLTEKEINTLNDWETKFEAKYPVVGRVVS 109 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 250,143,483,431 Number of Sequences: 7387702 Number of Extensions: 250143483431 Number of Successful Extensions: 138270154 Number of sequences better than 0.0: 0 |