BLASTX 7.6.2 Query= RU10932 /QuerySize=330 (329 letters) Database: GenBank nr; 7,387,702 sequences; 2,551,671,255 total letters Score E Sequences producing significant alignments: (bits) Value gi|157347880|emb|CAO22467.1| unnamed protein product [Vitis vini... 125 1e-027 gi|18379088|ref|NP_563683.1| BSD domain-containing protein [Arab... 119 9e-026 gi|18413928|ref|NP_567396.1| BSD domain-containing protein [Arab... 95 1e-018 gi|5123952|emb|CAB45510.1| putative protein [Arabidopsis thaliana] 95 1e-018 gi|110743041|dbj|BAE99413.1| hypothetical protein [Arabidopsis t... 95 1e-018 >gi|157347880|emb|CAO22467.1| unnamed protein product [Vitis vinifera] Length = 334 Score = 125 bits (313), Expect = 1e-027 Identities = 56/84 (66%), Positives = 69/84 (82%) Frame = -1 Query: 329 RFESQVRAIQGDASTYCEEPEDLEEYRQWRSGFVLEEKREEIEGLLEGNGAMESIYNKVA 150 RF++QVRAIQ D +TY EEPEDL++Y +W+ FVL++K EEI+ LLE NGAME IYN++ Sbjct: 42 RFDAQVRAIQNDVNTYVEEPEDLDDYNKWKLEFVLDDKGEEIQNLLEENGAMEGIYNRIV 101 Query: 149 PNVVDDETFWSRYYYRVYKLKQAE 78 P VD ETFW RY+YRVYKLKQAE Sbjct: 102 PKNVDQETFWFRYFYRVYKLKQAE 125 >gi|18379088|ref|NP_563683.1| BSD domain-containing protein [Arabidopsis thaliana] Length = 470 Score = 119 bits (296), Expect = 9e-026 Identities = 51/84 (60%), Positives = 68/84 (80%) Frame = -1 Query: 329 RFESQVRAIQGDASTYCEEPEDLEEYRQWRSGFVLEEKREEIEGLLEGNGAMESIYNKVA 150 RF++Q+RA+QGD +TYCEEPED ++Y++W S F L+ K EE+E LLE NG M+ +Y +V Sbjct: 151 RFDAQIRAVQGDLNTYCEEPEDSDDYKKWESAFSLDGKAEEMEKLLEENGDMKGVYKRVV 210 Query: 149 PNVVDDETFWSRYYYRVYKLKQAE 78 P++VD ETFW RY+YRV KLKQAE Sbjct: 211 PSMVDHETFWFRYFYRVNKLKQAE 234 >gi|18413928|ref|NP_567396.1| BSD domain-containing protein [Arabidopsis thaliana] Length = 316 Score = 95 bits (235), Expect = 1e-018 Identities = 42/84 (50%), Positives = 55/84 (65%) Frame = -1 Query: 329 RFESQVRAIQGDASTYCEEPEDLEEYRQWRSGFVLEEKREEIEGLLEGNGAMESIYNKVA 150 RFE + A+Q D T+ EP+DL ++ W G LEEKR EI L+ GN ++ IY ++ Sbjct: 130 RFEMMLLALQSDKGTFVREPDDLSDFENWSLGLKLEEKRNEIVELINGNKGVKEIYEEIV 189 Query: 149 PNVVDDETFWSRYYYRVYKLKQAE 78 P VD ETFW RYYY+VYKL+Q E Sbjct: 190 PVEVDAETFWRRYYYKVYKLEQVE 213 >gi|5123952|emb|CAB45510.1| putative protein [Arabidopsis thaliana] Length = 365 Score = 95 bits (235), Expect = 1e-018 Identities = 42/84 (50%), Positives = 55/84 (65%) Frame = -1 Query: 329 RFESQVRAIQGDASTYCEEPEDLEEYRQWRSGFVLEEKREEIEGLLEGNGAMESIYNKVA 150 RFE + A+Q D T+ EP+DL ++ W G LEEKR EI L+ GN ++ IY ++ Sbjct: 179 RFEMMLLALQSDKGTFVREPDDLSDFENWSLGLKLEEKRNEIVELINGNKGVKEIYEEIV 238 Query: 149 PNVVDDETFWSRYYYRVYKLKQAE 78 P VD ETFW RYYY+VYKL+Q E Sbjct: 239 PVEVDAETFWRRYYYKVYKLEQVE 262 >gi|110743041|dbj|BAE99413.1| hypothetical protein [Arabidopsis thaliana] Length = 302 Score = 95 bits (235), Expect = 1e-018 Identities = 42/84 (50%), Positives = 55/84 (65%) Frame = -1 Query: 329 RFESQVRAIQGDASTYCEEPEDLEEYRQWRSGFVLEEKREEIEGLLEGNGAMESIYNKVA 150 RFE + A+Q D T+ EP+DL ++ W G LEEKR EI L+ GN ++ IY ++ Sbjct: 116 RFEMMLLALQSDKGTFVREPDDLSDFENWSLGLKLEEKRNEIVELINGNKGVKEIYEEIV 175 Query: 149 PNVVDDETFWSRYYYRVYKLKQAE 78 P VD ETFW RYYY+VYKL+Q E Sbjct: 176 PVEVDAETFWRRYYYKVYKLEQVE 199 Database: GenBank nr Posted date: Wed Dec 03 02:04:20 2008 Number of letters in database: 2,551,671,255 Number of sequences in database: 7,387,702 Lambda K H 0.267 0.041 0.140 Gapped Lambda K H 0.267 0.041 0.140 Matrix: blosum62 Gap Penalties: Existence: 11, Extension: 1 Number of Hits to DB: 301,939,573,105 Number of Sequences: 7387702 Number of Extensions: 301939573105 Number of Successful Extensions: 164633019 Number of sequences better than 0.0: 0 |